SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002336 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002336
Domain Number 1 Region: 728-1089
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.46e-103
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000000000028
Further Details:      
 
Domain Number 2 Region: 526-725
Classification Level Classification E-value
Superfamily ARM repeat 8.34e-62
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.00000000398
Further Details:      
 
Domain Number 3 Region: 351-524
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.05e-53
Family PLC-like (P variant) 0.0000000341
Further Details:      
 
Domain Number 4 Region: 144-321
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.19e-50
Family Ras-binding domain, RBD 0.0000000261
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002336   Gene: ENSMLUG00000002568   Transcript: ENSMLUT00000002570
Sequence length 1102
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429785:8892114:8924101:-1 gene:ENSMLUG00000002568 transcript:ENSMLUT00000002570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELESNEQPVVLREDNRRRRRRMKPRGSAASLSSMELIPIEFVLPTSQRTSKTPETALLH
VAGHGNVEQMKAQVWLRALETSAAADFYQRLSPDHFLLLYQKKGQWYEIYDKYQVVQTLD
CLRYWKVLHRSPGQIHVVQRRGPSEETLAFQRQLTALMGYDVTDVSNVHDDELEFTRRRL
VTPRMAEVAGRDPQLYAMHPWVTSKPLPEYLLKKIAHNCIFIVIHRSTTSQTIKVSADDT
PAAILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPLKNFQWVRHCLKNG
EEIHLVLDAPPDPAQDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHDSVFTVSLWDCDRK
FRVKIRGIDIPVLPRNADLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIRI
KDLPKGALLNLQIYCGKAPALSGKASAETPSPEARGKAQLLYYVNLLLIDHRFLLRHGEY
VLHMWQISGKGEDQGSFNADKLTSATNPDKDSSMSICILLDNYCHPIALPKHRPTPDPEG
DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQ
QEMVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLNYL
LQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
LRGCGTAMLHDFTQQVQVIEMLQKVTIDIKSLSAEKYDVSSQVISQLKQKLENLQNSNLP
KSFRVPYDPGLKAGALVVEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQ
DMLILQILRIMESIWEIESLDLCLLPYGCISTGDKIGMIQIVKDATTIAKIQQSTVGNTG
AFKDEVLNHWLKEKCPIEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNL
FHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSLHFQKFQEVCTKAYLAL
RHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGW
TVQFNWFLHLVLGIKQGEKHSA
Download sequence
Identical sequences G1NY61
ENSMLUP00000002336 XP_006085446.1.53796 XP_006085447.1.53796 XP_014308292.1.53796 ENSMLUP00000002336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]