SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002338 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002338
Domain Number 1 Region: 97-196
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-28
Family PDZ domain 0.0000223
Further Details:      
 
Domain Number 2 Region: 430-555
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-27
Family SH3-domain 0.00000913
Further Details:      
 
Domain Number 3 Region: 200-294
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-26
Family PDZ domain 0.0000193
Further Details:      
 
Domain Number 4 Region: 346-376
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000252
Family PDZ domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000002338
Domain Number - Region: 25-50
Classification Level Classification E-value
Superfamily L27 domain 0.00671
Family L27 domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002338   Gene: ENSMLUG00000002562   Transcript: ENSMLUT00000002572
Sequence length 559
Comment pep:known_by_projection scaffold:Myoluc2.0:GL431304:14178:35274:1 gene:ENSMLUG00000002562 transcript:ENSMLUT00000002572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSERPRAPRSALWLLAPPLLRWAPSLLRVLHSDLFQALLDILDCYEASISESQKYRYQDE
DTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGF
SIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEAL
KEAGSIVRLYVMRRKPPAEKLMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEG
GAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAP
PDITTSYSQHLDNEMSHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIH
RGSTGLGFNIVGGEDGEGTTAEAFGPSELWAAQTPGPGGAPWQRAPAVDPALTAELGLSQ
ALTGGRLSSRALFDYDKTDCGFLSQALSFHFGDVLHVIDASDEEWWQARRVHSDSETDDI
GFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKD
RANDDLLSEFPDKFGSCVP
Download sequence
Identical sequences G1NY63
ENSMLUP00000002338 ENSMLUP00000002338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]