SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002360 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002360
Domain Number 1 Region: 353-484
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.07e-32
Family DEP domain 0.0000226
Further Details:      
 
Domain Number 2 Region: 179-291
Classification Level Classification E-value
Superfamily PDZ domain-like 2.66e-23
Family PDZ domain 0.0000261
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000002360
Domain Number - Region: 1-26
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00227
Family DIX domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002360   Gene: ENSMLUG00000002591   Transcript: ENSMLUT00000002595
Sequence length 671
Comment pep:known_by_projection scaffold:Myoluc2.0:GL431304:2575:7126:1 gene:ENSMLUG00000002591 transcript:ENSMLUT00000002595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVKEEISDDNARLPCFNGRVVSWLVSSDNPQPEIAPPAQEPRTELVPPTPPLPPLPPERT
SGIGDSRPPSFHPNVSSSRENLEPETETESVVSLRRERPRRRDSSEHGAGGHRPSGPSRL
ERHLAGYESSSTLMTSELESTSLGDSDEDDTTSRFSSSTEQSSASRLLKRHRRRRKQRPP
RLERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAV
AADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQAYFTL
PRNEPIQPIDPAAWVSHSAALTGTFPAYPGSSSMSTITSGSSLPDGCEGRGLSIHTDMAS
VTKAMASPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYASGLLKA
GLIRHTVNKITFSEQCYYVFGDLSGGCEGYLVNLSLNDNDGSSGASDQDTLAPLPGATPW
PLLHTFPYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGGAGRPG
RPEERAPESKSGSGSESEPSSRGGSLRRGGEPGGTGDGGPPPSRSSSGGAPNLRTHPGLH
PYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVPPELTASRQSFHMAM
GNPSEFFVDVM
Download sequence
Identical sequences G1NY83
ENSMLUP00000002360 ENSMLUP00000002360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]