SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002428 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002428
Domain Number 1 Region: 39-107
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000172
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000002428
Domain Number - Region: 194-237
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00195
Family Ubiquitin-related 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002428   Gene: ENSMLUG00000002673   Transcript: ENSMLUT00000002671
Sequence length 261
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429953:2398295:2400580:-1 gene:ENSMLUG00000002673 transcript:ENSMLUT00000002671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPQGGQIAIAMRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTI
TECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEE
KRIREFYQSRGLDRVTQPGGEEPALSNLGLPFCSFDHSKAHYYRYDEQLSLCLERLSPQS
GKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWL
SRWFGKPAPLLLQYSVKEKRR
Download sequence
Identical sequences G1NYE1
ENSMLUP00000002428 ENSMLUP00000002428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]