SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002430 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002430
Domain Number 1 Region: 321-625
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.11e-113
Family Mammalian PLC 0.000000394
Further Details:      
 
Domain Number 2 Region: 161-319
Classification Level Classification E-value
Superfamily EF-hand 6.52e-38
Family EF-hand modules in multidomain proteins 0.01
Further Details:      
 
Domain Number 3 Region: 646-770
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.93e-31
Family PLC-like (P variant) 0.00037
Further Details:      
 
Domain Number 4 Region: 32-145
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-26
Family Pleckstrin-homology domain (PH domain) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002430   Gene: ENSMLUG00000002677   Transcript: ENSMLUT00000002675
Sequence length 1018
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429770:4190320:4238769:1 gene:ENSMLUG00000002677 transcript:ENSMLUT00000002675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILQDPANQKGGGRKKTVSFSSMPSEKKVSSASDCISFMQAGCELKKVRPNSRIYNRFFTL
DTDLLALRWEPSKKDPEKAKLDISAVKEIRLGKNTETFRNNGLADQICEDCAFSILHGEN
YESLDLVAHSADVANIWVSGLRYLVSRSKQPLDFMEGNQNTPRFMWLKTVFVAADVDGNG
IMLEDTAVELIKQLNPTLKESKIRLKFKEIQKSKEKLTTRVTEEEFCEAFCELCTRPEVY
FLLVQISKNKEYLDANDLMLFLEAEQGVTQITEDMCLDIIRRYELSEEGRQKGFLAIDGF
TQYLLSPECDLFDPEQKKVAQDMTQPLSHYYISASHNTYLIEDQFRGPADINGYVRALKM
GCRSIELDVSDGSDGEPVLCNRNNMSTHLSFRSVVEVINKFAFVASEYPLILCLGNHCSL
PQQKVMAQQMKKVFGTKLYTEAPSPSEAYLPSPEKLKRMIIVKGKKLPSDSDASEGEVTD
EDEEAEISRRMSVDYNGEQKHIWLCRELSDLVSICQSVQYRDFELSMRSQNYWEICSFSE
SEASRIANEYPEDFVNYNKKFLSRIYPSAMRIDSSNLNPQDFWNCGCQIVAMNFQTPGPM
MDLHTGWFLQNGGCGYVLRPSIMRDEVSYFSANTKGVVPGVSPLALHIKIISGQNFPKPK
GACAKGDVLDPYVCIEIHGIPADCSEQRTKTVQQNSDNPIFDETFEFQVNLPELAMIRFV
VLDDDYIGDEFIGQYTIPFECLQPGYRHVPLRSFVGDIMEHVTLFVHIAITNRSGGGKAQ
KRSLSVRMGKKVREYTMLRNVGLKPIDDIFKIAVHPLREAIDMRENMQNAIVSVKELCGL
PPIASLKQCLLTLSSRLIASDNTPSVSLVMKDSFPYLEPLGAIPDVQKKMLAAYDLMIQE
SRFLIEMADTVQEKIVQCQKAGMEFHEELHNLGAKEGLKGRKLNKATESFAWNITVLKGQ
GDLLKSAKNEALENMKQIQLACLSCGLSKAPSGAAEAKSKRSLEAIEEKEGGEENGKL
Download sequence
Identical sequences G1NYE2
ENSMLUP00000002430 ENSMLUP00000002430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]