SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002448 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002448
Domain Number 1 Region: 322-335,366-573
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 8.19e-35
Family Cofactor-dependent phosphoglycerate mutase 0.029
Further Details:      
 
Domain Number 2 Region: 202-266
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000174
Family SH3-domain 0.0014
Further Details:      
 
Domain Number 3 Region: 1-33
Classification Level Classification E-value
Superfamily UBA-like 0.00000567
Family UBA domain 0.0051
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000002448
Domain Number - Region: 35-162
Classification Level Classification E-value
Superfamily LigT-like 0.000872
Family Atu0111-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002448   Gene: ENSMLUG00000002693   Transcript: ENSMLUT00000002695
Sequence length 587
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430409:42990:79716:-1 gene:ENSMLUG00000002693 transcript:ENSMLUT00000002695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KALASTGGRSVQAACDWLFSHVGDPFLDDPLPREYVLYLRPTGPLAQKLSDFWQQSKQIC
GKNKAHNIFPHITLCQFFMCEDSKADALGEVLQATVSRWRGKFSVPLPLELYTSSNFIGL
FVEEASADVLKKFAADFAAEAASKTEVHVEPHKKQLHVTLAYHFQASHLPTLEKLAQSID
VKLGCDWLAAIFSRDIRFANHETLQVIYPYTPQNDDELELVPGDFIFMSPVEQASTSEGW
VYGTSLTTGGSGLLPENYITKADECSTWVFHRIFTNNQTTSIWSRLSGGSSQRGALKART
SFTSEQLLLLLTMAVALIRKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLNMPH
SLPQRSGGFRDYEKDAPITVFGCMQARLVGEALLESNTIIDHVYCSPSLRCVQTAHNILP
QGLQQENHLKIRVEPGLFEWTKWVAGNTLPAWIPPSELAAANLSVDTTYRPHIPVSKLVV
SESYDTYISRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMV
RKIPYLGFCSCEELGETGIWQLRDPPILPLTHGPTGGFNWRETLLQD
Download sequence
Identical sequences G1NYF9
ENSMLUP00000002448 ENSMLUP00000002448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]