SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002452 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002452
Domain Number 1 Region: 295-426
Classification Level Classification E-value
Superfamily PH domain-like 1.76e-32
Family Ran-binding domain 0.00000581
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002452   Gene: ENSMLUG00000002697   Transcript: ENSMLUT00000002699
Sequence length 481
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429835:1769997:1804017:-1 gene:ENSMLUG00000002697 transcript:ENSMLUT00000002699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAVPGGGGSHLLRGLHTCRLRLPEGPQQREKSVIAQPIFVFEKREQSFKRPAEETLHEA
AEPECNGFSRKRIRASSFSLQTTDSQSQGVSTIPLRIMYCNDFTSVSRVKKNNVFMTPTI
VQRSVDMNSAEQSPLKHSEHVLRPAILQPPRAQRCEKVRHHALEHCKTKEQTKNKISEKN
SSLLSENMPSAGISIQLSTNQILLGAASVGCQPNEDKYSFKSCSSDFVFGENMVERVLGM
QKLTQPQLENDSYAKEKPFKYNLKFPINSPNSRTDAIKNMSLIESAAALSSKSSPKCLLK
KIDVITGEEAEYNVLKINCKLFVFNKTTPSWTERGRGALRLNDTAGSDRGAFQSRLIMRN
QGSLRLILNSKLWTQMEIQRANPRNLRVTATDLEDYSIKVFLIQATAKDTESLYAAIHHR
LVALRSFEKQKDINQADSQAEAALPQLNCDSCDEDEDGFTQGTKNRSDPSRWTHRQSVAC
S
Download sequence
Identical sequences G1NYG3
ENSMLUP00000002452 ENSMLUP00000002452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]