SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002479 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002479
Domain Number 1 Region: 152-350
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.4e-70
Family Arfaptin, Rac-binding fragment 0.000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002479   Gene: ENSMLUG00000002725   Transcript: ENSMLUT00000002726
Sequence length 373
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429768:20807713:20865523:1 gene:ENSMLUG00000002725 transcript:ENSMLUT00000002726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQESPRNSAAEIAVTSNGEVDDSHEHGFNKDLKHSLPAGLGLSETQITSHGFDSTKEGV
IEAGAYQGPSAPPLPSVMSPSRVAASQLAQQGSDLIVPAGGQRTQTKSGPVILADEIKNP
AMEKLELVRKWSLNTYKCTRQIISEKLGRGSRTVDLELEAQIDILRDNKKKYENILRLAQ
TLSTQLFQMVHTQRQLGDAFADLSLKSLELHEEFGYNADTQKLLAKNGETLLGAINFFIA
SVNTLVNKTIEDTLMTVKQYESARIEYDAYRTDLEELNLGPRDANTLPKIEQSQHLFQAH
KEKYDKMRNDVSIKLKFLEENKVKVLHNQLVLFHNAIAAYFAGNQKQLEQTLKQFHIKLK
TPGVDAPSWLEEQ
Download sequence
Identical sequences G1NYI6
XP_005871482.1.60319 XP_006081849.1.53796 XP_014311478.1.53796 XP_014399382.1.60319 XP_014399383.1.60319 ENSMLUP00000002479 ENSMLUP00000002479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]