SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002499 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002499
Domain Number 1 Region: 47-248
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.72e-64
Family Arfaptin, Rac-binding fragment 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002499   Gene: ENSMLUG00000002746   Transcript: ENSMLUT00000002748
Sequence length 469
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429770:7528849:7543843:-1 gene:ENSMLUG00000002746 transcript:ENSMLUT00000002748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PCSHSMDSFGQPRAEDNQSVVSRMQKKYWKTKQVLIKATGKKEDEHVVASDADLDAKLEV
FHSIQETCTELLKIVEKYQLRLNVVSEEENELGLFLKFQAERDATQAGKLMDATGKALCS
SAKQRLALYTPLSRLKQEVATFSQRAVSDTLTTINRMEQARTEYRGALLWMKDVSQELDP
DTLKQMEKFRKVQIQVRSSKAAFDKLKMDVCQKVDLLGASRCNMLSHSLATYQRTLLGFW
EKTARTMSQIYGAYIGLHPYDFVALKQLQDTSSKLEGDHKEEQNKSSKPTAGPGPGSLDR
VEGDHYEEVNLRSESGKMVNSLNQRGLVTECGPMSVLQRKKPVCFCCHSTVAKDLPGDSL
EDDFEKEFSFLNNLLSPTSSSSSEFTQECQTAFGSLTFQEPPVGSEPLAHSQRFLPSQLF
DLGLHAAGAFNTPNHGNQGMSAWFNLFADMDPLSNPDAIGHSDDELLNA
Download sequence
Identical sequences G1NYK4
ENSMLUP00000002499 ENSMLUP00000002499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]