SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002503 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002503
Domain Number 1 Region: 4-165,203-328
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.08e-62
Family FCH domain 0.0022
Further Details:      
 
Domain Number 2 Region: 474-659
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.35e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.0000964
Further Details:      
 
Domain Number 3 Region: 711-766
Classification Level Classification E-value
Superfamily SH3-domain 4.33e-16
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002503   Gene: ENSMLUG00000002742   Transcript: ENSMLUT00000002752
Sequence length 1051
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429912:1590544:1727833:1 gene:ENSMLUG00000002742 transcript:ENSMLUT00000002752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAEIRAQLTEQMKCLDQQCELRVQLLQDLQDFFRKKAEIEMDYSRNLEKLAERFLAKTRS
TKDQQFKKDQNVLSPVNCWNLLLNQVKRESRDHTTLSDIYLNNIIPRFVQVSEDSGRLFK
KSKEVGQQLQDDLMKVLNELYSVMKTYHMYNADSISAQSKLKEAEKQEEKQIGKSVKQED
RQTPRSPDSSSNIRIEEKHVRRSSVKKIEKMKEKRQAKYTENKLKAIKARNEYLLALEAT
NASVFKYYIHDLSDLIDQCCDLGYHASLNRALRTFLSAELNLEQSKHEGLDAIENAVENL
DATSDKQRLMEMYNNVFCPPMKFEFQPHMGDMASQLCAQQPVQSELVQRCQQLQSRLSTL
KIENEEVKKTMEATLQTIQDIVTVEDFDVSDCFQYSNSMESVKSTVSETFMSKPSIAKRR
ANQQETEQFYFTKMKEYLEGRNLITKLQAKHDLLQKTLGESQRTDCSLARRSSTVRKQDS
SQAIPLVVESCIRFISRHGLQHEGIFRVSGSQVEVNDIKNAFERGEDPLAGDQNDHDMDS
IAGVLKLYFRGLEHPLFPKDIFHDLMACVTMDNLQERALHIRKVLLVLPKTTLIIMRYLF
AFLNHLSQFSEENMMDPYNLAICFGPSLMSVPEGHDQVSCQAHVNELIKTIIIQHENIFP
NPRELEGPVYSRGGSMEDYCDSPHGETASVEDSTQDVSTEHHTSDDECEPIEAIAKFDYV
GRTARELSFKKGASLLLYQRASDDWWEGRHNGIDGLIPHQYIVVQDTEDGVVERSSPKSE
IEVISEPPEEKVTARAGASCPSGGHVADIYLANINKQRKRPESGSIRKTFRSDSHGLSGS
LTDSASSGVGAGCRPSSQPIMSQSLPKEGPDKCSISGHGSLNSISRHSSLKNRLDSPQIR
KTVTAGRSKSFNNHRPMDPEVIAQDIEATMNSALNELRELERQSSVKHTPDVVLDTLEPL
KTSPVVAPTSEPSSPLHTQLLKDPEPAFQRSASTAGDIACAFRPVKSVKMAAPVKPPATR
PKPTVFPKTNATSPGVNASASPQSTDKSCTV
Download sequence
Identical sequences G1NYK8
ENSMLUP00000002503 ENSMLUP00000002503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]