SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002515 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002515
Domain Number 1 Region: 1-181
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.39e-52
Family Cyclophilin (peptidylprolyl isomerase) 0.0000293
Further Details:      
 
Domain Number 2 Region: 223-333
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.33e-29
Family Canonical RBD 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002515   Gene: ENSMLUG00000002766   Transcript: ENSMLUT00000002765
Sequence length 493
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429824:167397:195700:1 gene:ENSMLUG00000002766 transcript:ENSMLUT00000002765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVLLETTLGDVVIDLYTEERPRACLNFLKLCKIKYYNYCLIHNVQRDFIIQTGDPTGTG
RGGESVFGQLYGDQARFFDAEKVPRIKHKKKGTVSMVNNGSDQHGSQFLITTGDNLDYLD
GVHTVFGEVTEGMDIIKKINETFVDKDFVPYQDIRINHTVILDDPFDDPPDLLIPDRSPE
PTREQLDSGRIGADEEIDDFKGRSAEEVEEIKAEKEAKTQAILLEMVGDLPDADIKPPEN
VLFVCKLNPVTTDEDLEIIFSRFGPIRSCEVIRDWKTGESLCYAFIEFEKEEDCEKAFFK
MDNVLIDDRRIHVDFSQSVAKVKWKGKEIGGRYTKSDFKEYEKEQDKSSNLVLKDKVKPK
QDAKYDLILEEQSEDSKSSHSHTSKKHKKKTRHCSEEKEDENYMPIKNTNQDIYREMGFG
HYEEESCWEKQKNEKKDRTQNRSRSRSRERDGHYSNSHKSKYQTDPYERERNKKRDRSRS
PRKSKDKEKSKYR
Download sequence
Identical sequences G1NYM0
ENSMLUP00000002515 ENSMLUP00000002515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]