SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002535 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002535
Domain Number 1 Region: 39-136
Classification Level Classification E-value
Superfamily Immunoglobulin 1.04e-16
Family V set domains (antibody variable domain-like) 0.0033
Further Details:      
 
Domain Number 2 Region: 153-223
Classification Level Classification E-value
Superfamily Immunoglobulin 2.84e-16
Family I set domains 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002535   Gene: ENSMLUG00000022335   Transcript: ENSMLUT00000002786
Sequence length 231
Comment pep:novel scaffold:Myoluc2.0:GL430081:666416:669222:1 gene:ENSMLUG00000022335 transcript:ENSMLUT00000002786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFPAAPARRGLVPWLGVLPSVFLLTLWIPPTTARFAVVSTSALEGQDVILHTHNRPPNC
AGFIWYRGDKTDYNHFIASLTLHSRRSVRGPKYSGQETVNLDGFLTIRKVTLKDTGTYTV
IAVLENSLREIGCGQLDVYRPVSVPTLLASNTTVTENEDAVVMTCHTDASSTNWLFNATS
LRLRKRMKLSQDHRTLTIDPVRREDAGNYQCKVSNPVSSTESAPVELDVKY
Download sequence
Identical sequences L7N138
ENSMLUP00000002535 ENSMLUP00000002535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]