SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002587 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002587
Domain Number 1 Region: 720-916
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.42e-45
Family WD40-repeat 0.0001
Further Details:      
 
Domain Number 2 Region: 121-182
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000275
Family B-box zinc-binding domain 0.001
Further Details:      
 
Domain Number 3 Region: 353-412
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000364
Family SPRY domain 0.0064
Further Details:      
 
Domain Number 4 Region: 577-698
Classification Level Classification E-value
Superfamily F-box domain 0.0000000089
Family F-box domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002587   Gene: ENSMLUG00000002838   Transcript: ENSMLUT00000002846
Sequence length 928
Comment pep:novel scaffold:Myoluc2.0:GL429966:51262:106574:1 gene:ENSMLUG00000002838 transcript:ENSMLUT00000002846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGAEAGKLCRSAFQMAELDLMAPGPLPGIAAHSLVTLSPDSGSASPAEEDKGSVESPQGE
VEGPGAGSQDGGGGEEEIPCDFCLGAQRVKAVKSCLTCMLNYCEEHLRPHRENSKLHSHQ
LTEPVKDRDLPTCPAHHSPLVAFCRPDRQCICQECGQDQHKGHASVSLNVARRDKEAELR
STQLDLERKLKLNENAIARLQANHKSVLVSVSEVKMVAEEQFGELLAAVRKAQGQANGIK
THLEHSSAEMEKSRQELGRIAAISNTVLFLEEYCKFKNTEDSAFPSVYIGLKDKLSGIRK
VITDSTVHLVQLLHNYKEKLQEFAKDEEYDIRTQVSAVVELKYRTSKPEPSTRQQFLQYA
CDIAFDPDTAHRYLRLQEDNRKVTNTTPWEHPYPDLPSRFLHWRQVLSQQSLYLHRLILH
FLRPSSVTEFCIVSLTDLLLDCFPFLPTAPFQGPPIHPGSKDNQKGELGQDPNLMLLFPE
KYYNPQLDTSNVYWTAKTKSTSFPLSKDSGGKGLLKNVGWEASNTEGQWRSSLQCISEMN
RLYSRKAHMPKAGYTSCNLLVDLDVVRDLSSGASKYRDFIRQLPIHISKYILSMLDKSTL
NRCAAVSQHWAALAKKVKKDFSIHSFIHNQIALLQGSYTKGIDPTYACKLFVPVPKMTDE
IKRTRAKNQKWKLRTKTDNSLWTAYQNQEIQQIQMEERNVFCGTYNIHILSDTWDRNRII
HYSGGDVVAVSSNRKIQLLDVLQAKEIPVQFRGHTGSIRALFVCEEENVLLSGSYDLSIR
YWDLKSGACIRIFTGHQGTITCIDLYNKMLVSGAKDCQVKEWDINTGKCLKTFKHKDPIL
AIKINDTYIVSSCERGIVKVWHIVMAQVVKILSGHEGAVKCLCFDQWHLLSGSVDGLVMA
WSMVGKYERCLMAYKHPKYVPGNNNTRC
Download sequence
Identical sequences G1NYT3
ENSMLUP00000002587 ENSMLUP00000002587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]