SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002593 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000002593
Domain Number - Region: 44-142
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 0.0146
Family Glycerophosphoryl diester phosphodiesterase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002593   Gene: ENSMLUG00000002854   Transcript: ENSMLUT00000002853
Sequence length 276
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429767:35352571:35365922:-1 gene:ENSMLUG00000002854 transcript:ENSMLUT00000002853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FHGNAVILGSWSENILQYFLRNNQITTEDGAQITWYHAANHKAQMNEALKSTAHMIEADV
LLPSEGSDHGQPIMAHPPETSSDNTLQEWLTEVTKSNKGIKLDFKSLAAVEPAMMLLENV
KKHLKRPVWINADILPGPNGNSRVVDAKPFIDTVTSFFPDVTFSLGWTTGWHPEKVNEGY
SWTMVKEMECICNELSQPVTFPVRAALVRQSCSQFLWLLKKSNRYSLTIWTGKNDNYSIE
DLLCIRDYFDKKQVFYDILEPQNCEFKQAIGIKVNL
Download sequence
Identical sequences G1NYT7
ENSMLUP00000002593 ENSMLUP00000002593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]