SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002614 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002614
Domain Number 1 Region: 170-430
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.41e-61
Family Nuclear receptor ligand-binding domain 0.00000000353
Further Details:      
 
Domain Number 2 Region: 36-119
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-24
Family Nuclear receptor 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002614   Gene: ENSMLUG00000002877   Transcript: ENSMLUT00000002876
Sequence length 434
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429851:2725724:2736799:1 gene:ENSMLUG00000002877 transcript:ENSMLUT00000002876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRPEESWNHHDLEHRREADSTPGKPAVNGEEGDGEPHICRVCGDKATGYHFNVMTCEGCK
GFFRRAMKRNARLRCPFRKGTCEITQKTRRQCQACRLRKCLESGMRKEMAWCSKFVHIKR
GLIRNRSVRDEIRYRPSHPPQGQGASPCLMGRGRDVRDINSQIQKVHHLIGDQLPEVLSS
GHELPESLQTPPGEEATKWSKIREDLSSLKVVSLQLRGEDGSIWNYKPPAEGSGKEIFSL
LPHMADMSTYMFKGIINFAKVISHFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTW
ECGRLSYCLEDPAEGFQQLLLEPMLKFHYMLKELRLREEEYVLMQAISLFSPVLPCTEPG
GIMGKVRPRSQTRSRRDRCLQPLPARRFLFLKIMARLTELRSINAQHTQRLLRIHDIHPF
ATPLMQELFSISDA
Download sequence
Identical sequences G1NYV4
ENSMLUP00000002614 ENSMLUP00000002614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]