SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002636 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002636
Domain Number 1 Region: 74-139,178-315
Classification Level Classification E-value
Superfamily PH domain-like 1.86e-21
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 2 Region: 367-509
Classification Level Classification E-value
Superfamily PH domain-like 8.66e-20
Family Pleckstrin-homology domain (PH domain) 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002636   Gene: ENSMLUG00000002902   Transcript: ENSMLUT00000002901
Sequence length 772
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429969:397531:454991:-1 gene:ENSMLUG00000002902 transcript:ENSMLUT00000002901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRGRVLEQLLPELTGLLSLLDHEYLSDTTLEKKMAVASILQSLQPLPEKEVSYLYVNTA
DLHSGPSFVESLFEEFDCDLSDLRDMPEDDGEPGKGASPEPAKSPSLKHAADLPPPLPNR
PPPEDYYEEALPLGPGKSPEYISSHNGCSPAHSIVDGYYEDADSSYPSTRMNGEMKSSYN
DSDAMSSSYESYDEEEEDGKGLQPTHQWPSEEASMHLVRDCRICAFLLRKKRFGQWAKQL
TVIKEDQLLCYKSSKDRQPHLRLALDACNVIYVPKDSRHKRHELRFSQGATEILVLALQS
REQAEEWLKVIREVSKPITGAEGADMPRSPVLLCKLDLDKRLSQEKQTSDSDSLGMSDNC
STLGRREAGEHATGKGKKSSLAELKGSMSRAAGRKITRIISFSKRKALADDLPMSSTEEA
VPCCGYLNVMVNHGWKERWCRLKCNTLYFHKDRTDLRTHVNAIALGGCEVAPGFGPRHPF
AFRILRNRQEVAILEASCSEDMGRWLGLLLVEMGSKVTPEALHYDYVDVETLTSIVSAGR
NSFLYARSCQDQWPEPRVYDDVPYEKMQDEEPERPTGAHVKRHASSCSEKSHRVDPQVKV
KRHASSANQYKYGKNRAEEDARRYLVEKEKLEKEKETIRTELMALRQEKRALKDAIRNNP
ETGAKLKVLQEAVATLEAQCRAKEEHRIDLELKLVAVKERLQRSLAGGPALGLSVGSKNK
SAETANKPQNNPPEQPLPVNCVSELRKRSPSIVTSNQGRVLQKAKEWEMKKT
Download sequence
Identical sequences G1NYX5
ENSMLUP00000002636 ENSMLUP00000002636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]