SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002642 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002642
Domain Number 1 Region: 66-314
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.38e-57
Family Glycerophosphoryl diester phosphodiesterase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002642   Gene: ENSMLUG00000002905   Transcript: ENSMLUT00000002907
Sequence length 331
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429812:259119:270949:-1 gene:ENSMLUG00000002905 transcript:ENSMLUT00000002907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLWETQGGLLGPFSFLLLLFLLVTRSPCNACLFTGILYLLLRLFSFEPLPARRALQVLQ
PRDRVSAIAHRGGCHDAPENTLAAIRQAAKNGATGVELDIEFTSDGVPVLMHDNTVDRTT
DGTGRICDLTFEQIRKLNPAANHRLRNDFPNEKIPTLREGVVESLNQNLTIFFDVKGHAN
KAIDALKKIYMEFPQLYNTSMVCSFLPEVIYKMRQTDRNVVTALTHRPWSLSHTGDGKPR
YDNMWKLSTFVVLDILLDWSMHNVLWYLCGISAFLVQKDSISPNYLKKWSAKGIQVVGWT
VNTFDEKSYYESYLGSSYITDSMLEDCPPHY
Download sequence
Identical sequences G1NYY0
ENSMLUP00000002642 XP_006088259.1.53796 ENSMLUP00000002642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]