SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002727 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002727
Domain Number 1 Region: 467-691
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.07e-23
Family Voltage-gated potassium channels 0.0046
Further Details:      
 
Domain Number 2 Region: 830-872
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000511
Family cAMP-binding domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000002727
Domain Number - Region: 700-751
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000845
Family cAMP-binding domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002727   Gene: ENSMLUG00000002984   Transcript: ENSMLUT00000002999
Sequence length 1024
Comment pep:novel scaffold:Myoluc2.0:GL430415:336866:370685:-1 gene:ENSMLUG00000002984 transcript:ENSMLUT00000002999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSILPGGQEEPDDLILEEVDPHWEEDQAQDGSASPQGAAAVASAYMEENEAEEEMSREFS
WIQEDKEDEEDEEDEEEEEEPEAERCGEIEGQGHPLHRAAPHTRQVGENSSALQGGHGPG
CENGGGEFQTQGSFGPGASGRDGGSVLESRRGGGSSHQGSRETSEGHAGHLGHSVLLDSC
LVAEAGEDPGGVDRTVTQRASCQGSFQWHRTAGGARAETCSMGQRGGEEDQSRDVGHGTG
PLRGREGVGLMNLGGSWHVEKQGNTLSLSPQVPATEEHPEVQVEDTDADSHPLIEDKPPS
PERLPPSPAKSDTLTVPGSAAGTPQKNPPDVETEVREQLRTSPPLSVSLQGRGTSCQEMT
NDQDRASSSASQNSAVINERLQELVKLFKERTEKVKEKLIDPDVTSDEESPKPSPAKQAP
EPAAGTTPAGEAQAEEEHYCDMLCCKFKRRPWRKYQFPRSIDPLTTHLLFLLFLYFAVAM
FCLTSWVRWAFPYQTPGNLYFWLLMDYLCDLIYILDITVFQMRLQFVRGGDIITDKKEMR
NNYLKSPRFKMDLLCLLPLDLLYLKFGVNPLLRLPRCLKYMAFFEFNNRLESILSKAYGS
RVIRTTAYLLYSLHLNSCLYYWASAYQGIGSTHWVYDGVGNSYIRCYYWAVKTLITIGGL
PDPKTLFEIVFQLLNYFTGVFAFSVMIGQMRDVVGAATAGQTYYRSCMDSTVKYMNFYKI
PRSVQNRVKTWYEYTWHSQGMLGRHPTLLGLPSSCDPEASLGPLLSASLHFSERGLGGPW
APGAGRQEAWDLRGLSSGALPTPGGPGGKPLWMPPRHLSTYADPSLLAVGGGNRRTANVV
AHGFTNLFILDKKDLNEILVHYPESQKLLRKKARRMLKSNSKPKEKSVLILPPRAGTPKL
FNAALAAAGKMGARGAKGGQLAHLRARLKELAALEAAAKQQQLLEQAKSSEDAAGEVGSA
APDQPAPQEPPAPGSQPPASPGGAEKEAAGPQEEHSVQIRVSPGLDPGEQILLVEVPEEK
KEAE
Download sequence
Identical sequences G1NZ54
ENSMLUP00000002727 ENSMLUP00000002727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]