SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002756 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002756
Domain Number 1 Region: 205-270
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000021
Family PDZ domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002756   Gene: ENSMLUG00000003030   Transcript: ENSMLUT00000003032
Sequence length 941
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429768:5933653:5992026:1 gene:ENSMLUG00000003030 transcript:ENSMLUT00000003032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSALCGSCQSPSGLPGDPSSQKEEEDGYREDRASDSSSYSSASSDYDDLEPEWLDSVQ
KNGELFYLELSEDEEESLLPETPVVNHVRFSENEIIIEEDDYKEGKKYEPKLKRFTKILR
SRRLLPKRHNKKKSNDSGPVSILKHQSNQKTGVIVQQRYKDVTVYVNPKKLTVTKAKEQL
KLLEVLVGIIHQTKWSWRRTGKQAGGERLVVHGLLPGGSAMKSGQVLIGDVLVAVNDVDV
TSENIERVLSCIPGPTQVKLTLENAYAVKKETTQPRQKNAQSKTEGDLVKLLWGEEIEGN
QQNVLNTPHVVMYLTLELDSETSKEEQEILYHYPVSDASQKLKSVRGIFLTLCDMLENVT
GTQVTSSSLLLNGKQTHVAYWKESDKLLLIGLPAEEVPLPQLRNMIENVAQTLKFMYGSL
DSAFCQVENAPRLDHFFELFFLRALQPAKLHGRASPSAQQYEASSAVLLDNLPGVRWLTL
PQEIKMELDTALSDLEAADFAELSEDYYDMRRLYTILGSSLFYKGYLICSHLPKDDLIDI
AVYCRHYGLLPLAAKQRIGQLVIWREVFPRHHLQPSTDSNTEVFQEPEGRYFLLIVGWRH
YMLCVLLEAGGCSSKAIGNPGPDCIYVDQGKTTLQQLEGVGGRINERLASSPSPCLSCAD
WFLAGSHEKLDCLTTSPILSRLQGISKAATSPTCRRTLFGDYSLKTRKPSPSRSSGGSDS
GCEGGEGVGPSPHTTPDAVRRQKESDGLEESGALLKVSKKKSTLPNPFHLGNLKKELSEK
ELEVYNTLKLTSGPENTLFHYVALETVQGIFITPTHEEVAQLSGSIHPQLIKNFHQCCLS
IRAVFQQTLMEEKKKALNTADHSGSTNLVSSLNPVKEHGVLFECSPENWTDQRKAPPVMA
YWVVGRLFLHPKVQELYVCFHDSVTEIAIEMAFKLFFGLTL
Download sequence
Identical sequences G1NZ81
ENSMLUP00000002756 ENSMLUP00000002756 XP_006081729.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]