SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002798 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002798
Domain Number 1 Region: 241-569
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 5.67e-55
Family Diacylglycerol kinase-like 0.01
Further Details:      
 
Domain Number 2 Region: 791-917
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.16e-19
Family Ankyrin repeat 0.001
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000002798
Domain Number - Region: 36-93
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00698
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002798   Gene: ENSMLUG00000003064   Transcript: ENSMLUT00000003079
Sequence length 932
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429813:534487:782119:1 gene:ENSMLUG00000003064 transcript:ENSMLUT00000003079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKAISRAGLQHLTPAHPLGLPVANGPAKEPRATLDWSENAVNGEHLWLETNVSGDLCYLG
EENCQVRFAKSALRRKCAVCKIVVHTACIEQLEKINFRCKPTFREGGSRSPRENFVRHHW
VHRRRQEGKCKQCGKGFQQKFSFHSKEIVAISCSWCKQAFHNKVTCFMLHQIEEPCSLGA
HAAVIVPPTWIIKVKKPQNSLKASNRKKKRTSFKRKASKRGTEQENKGRPFVIKPISSPL
MKPLLVFVNPKSGGNQGTKVLQMFMWYLNPRQVFDLSQEGPKDALELYRKVPNLRILACG
GDGTVGWILSILDELQLSPQPPVGVLPLGTGNDLARTLNWGGGYTDEPVSKILCQVEDGT
IVQLDRWNLHVERNPDLPPEELEDGVCKLPLNVFNNYFSLGFDAHVTLEFHESREANPEK
FNSRFRNKMFYAGAAFSDFLQRSSRDLSKHVKVVCDGTDLTPKIQELKFQCIVFLNIPRY
CAGTMPWGNPGDHHDFEPQRHDDGYIEVIGFTMASLAALQVGGHGERLHQCREVMLLTYK
SIPMQVDGEPCRLAPAMIRISLRNQANMVQKSKRRTSMPLLNDPQSIPDRLRIRVNKISL
QDYEGFHYDKEKLREAFLSNWEMTPCGSLLEREGTIPLGILVVRGDCDLETCRMYIDRLQ
EDLQSVSSGSHRVHYQDQETSFPRALSAQRLSPRWCFLDDRSQEHLHFVMEISQDEVFIL
DPDMALSQQAGTPPGMPDLVVEQASGMSDWWNPSLRRRMLSDSGLGMITPRFEDSDMKDL
SHSHALQSPVSSEDHAILQAVITGDLMKLIESYKNGGSLLIQGPDHCSLLHHAAKTGNGE
IVKYILDHGPSELLDMADSETGETALHKAACQRNRAVCQLLVDAGASLRKTDSKGKTPQD
RAQQAGDPDLAAYLESRQNYKIIGHEDLETTV
Download sequence
Identical sequences G1NZB9
ENSMLUP00000002798 ENSMLUP00000002798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]