SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002843 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002843
Domain Number 1 Region: 399-424,493-547
Classification Level Classification E-value
Superfamily SH3-domain 9.98e-23
Family SH3-domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002843   Gene: ENSMLUG00000003133   Transcript: ENSMLUT00000003129
Sequence length 549
Comment pep:known_by_projection scaffold:Myoluc2.0:GL431427:13481:28799:-1 gene:ENSMLUG00000003133 transcript:ENSMLUT00000003129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWKASAGHAVSISQDDGGADDWETDPDFENDVSEKEQRWGAKTVQGSGHQEHINIHKLRE
NVYQEHRSLKEKELATGPRASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRG
FGGKFGVQVDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQG
KTEKHESQKDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYARGFGGKFGVQT
DRQDKCALGWDHQEKPELHDSQKAWGGGGGASRKPGERERLPRCPRSSCRGQALSPRCAV
SDYSKGFGGKYGVQKDRMDKNASTFEDVAKVPSTYQKTVPVEAANSKTSSIRANFENLAQ
EKEQEDRRRAEAERVQRMARERQEQEEARRQLDEQARAQRQSPPASPAPQPAPERPPSSP
VYEDAVSMKAEPSYRGPVSEPEPVYSREATDYREAGGQQGLAYTPEAVYTSTEAPGHYPE
EENTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGLCKGRYGLF
PANYVELRQ
Download sequence
Identical sequences G1NZF5
ENSMLUP00000002843 ENSMLUP00000002843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]