SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002874 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002874
Domain Number 1 Region: 134-281
Classification Level Classification E-value
Superfamily PH domain-like 1.19e-28
Family Phosphotyrosine-binding domain (PTB) 0.016
Further Details:      
 
Domain Number 2 Region: 306-439
Classification Level Classification E-value
Superfamily PH domain-like 1.78e-28
Family Phosphotyrosine-binding domain (PTB) 0.0000684
Further Details:      
 
Domain Number 3 Region: 59-83
Classification Level Classification E-value
Superfamily WW domain 0.000000000401
Family WW domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002874   Gene: ENSMLUG00000003148   Transcript: ENSMLUT00000003160
Sequence length 513
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429795:4981847:4987409:1 gene:ENSMLUG00000003148 transcript:ENSMLUT00000003160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GWACRRSSSRGRAGLRVQAGRGRRGVGAMLGKDYMLAIILVNCDDDLWGDQSLEGEPGLP
PGWRKIHDAAGTYYWHVPSGSTQWQRPTWEPGDAEEPGTVEAGRIWGLRPPKGRSFSSLE
SSLDRSNSLSWYGEESYIQSMEPGAKCFAVRSLGWVEVPEEDLAPGKSSIAVSNCIQQLA
QTRSRSQPPAGAWGEGQNMLMILKKDAMSLVNPLDHSLIHCQPLVHIRVWGVGSSKGRPA
RDFAFVAGDKDSCMLKCHVFRCDVPAKAIASALHGLCAQILSERVGVSGDSPCCSLDTIS
PEDLPRQAELLDAVSQAAQKYQALYMGTLPVTKAMGMDVLNEAIGILTTRGDREAWVPAT
LSVSDSLMTAHPIQAEADAEEEPLWQCPVRLVTFIGVGRDPHTFGLIADLGRQSFQCAAF
WCQPHAGGLSEAVQAACMSEHSVCLLHSETRAWGAQARARLRLKRTSSVDPGGPLPLPLL
KGGVGGAGAAPRKRGIFSFLDAFRLKPSLLHMS
Download sequence
Identical sequences G1NZI0
ENSMLUP00000002874 ENSMLUP00000002874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]