SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002944 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002944
Domain Number 1 Region: 160-396
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.73e-59
Family Nuclear receptor ligand-binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002944   Gene: ENSMLUG00000003238   Transcript: ENSMLUT00000003237
Sequence length 399
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429787:7684926:7689981:-1 gene:ENSMLUG00000003238 transcript:ENSMLUT00000003237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGEHHQWPGSILYNMLMSAKQKHEAEASEAREAPRARARGICWGCSCGAAPPLGGEGAP
GRRAVADLYRCCFCGEDHPRQGSILYHMLTNAKQVQEAPAVLRGACWGCACGAVPAVGRE
GLALLYRCCFCGQQHPRASIFYNLPASSKQMHAAQPVALPGAPWWNPWSGAQRRVSLQNP
QVVCEAASAALLRTMRFVKYLPCFQVLPLDQQLVLARSGWAPLLMLELAQDRINFEITET
LEPGWLQSVLTTRRRETEGDEPQPLPTPQERSIPPTEARLLPSAAEVQAIKGFLTKCWSL
GITAKEYAYLKGIVLFTPDLPGLRCVKYIQGLQWGTQQILGEHTRMMYRGYHVRVAELNS
VLFQLRFISANAVTELFFRSIIGAVSMDDMMLEMLCTTL
Download sequence
Identical sequences G1NZP4
XP_006085712.1.53796 ENSMLUP00000002944 ENSMLUP00000002944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]