SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003003 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000003003
Domain Number - Region: 84-226
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000628
Family FCH domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003003   Gene: ENSMLUG00000003297   Transcript: ENSMLUT00000003303
Sequence length 440
Comment pep:known_by_projection scaffold:Myoluc2.0:AAPE02068193:501:3867:1 gene:ENSMLUG00000003297 transcript:ENSMLUT00000003303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSSAPLAEDMDPELARYLNRNYWEKKQEEARKSPTPSAPAPLAEPAAQPVETHAAPAAAV
EQQFQNGESEESHAQFLKALQNAVSTFVNRMKSNHARGRSITNDSAVLSLFQSINSMHPQ
LLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQ
KLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQLRLEQQKQTIQMRAQMPAFSLPYAQLQA
MPAAGGVLYQPSGPTSFPGTYSPAGSVEGSPMHTVYMSQPAAAAGSPYPSVPGAGAGVVS
TYMYPAGVPGAQTAPQGPAGPAASPAYSSYQPTPTQGYQAFPPQTVPSQPPQPAGVGYMG
SQAVSMGYQPYSMQNLMTALPSQDASLQPPPQPYISGQQPMYQQMAPAGGPPQQPPPVAQ
QPPAQGLQVQGSEAQLISFD
Download sequence
Identical sequences G1NZU6
ENSMLUP00000003003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]