SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003024 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003024
Domain Number 1 Region: 319-613
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 5.02e-51
Family Glycerophosphoryl diester phosphodiesterase 0.002
Further Details:      
 
Domain Number 2 Region: 5-113
Classification Level Classification E-value
Superfamily Starch-binding domain-like 1.2e-21
Family Starch-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003024   Gene: ENSMLUG00000003324   Transcript: ENSMLUT00000003327
Sequence length 673
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429945:2300896:2350824:-1 gene:ENSMLUG00000003324 transcript:ENSMLUT00000003327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPSQVTFEIRGTLFPGEVFAICGSCDALGNWNPQNAVALLPENETDESMFWKATIVLSR
GESVQYRYFKGCFLEPKTIGGPCQVIVHKWETHLQPRSITPLESEIIIDDGQFGIHNGVE
NLDSGWLTCQTEIRLRLHYSEKPPVSITKKKFKKSRFRVKLTLEGLEEDDDDRVSPPVLH
KMSNTLEISLISDTEFKCKHSQPDCGYGLQPDRWTEYSIQTMEPDNLELIFDFFEEDLGE
HVVQGDTLPGHVGTACLLSSTIDESGKSAGVLTLPIMSRNSRQTIGKVREVDYIIIKPLP
GYSCDMKSSFSKYWKPRTPLDVGHRGAGNSTTTAKLAKVQENTIASLRNAASHGAAFVEF
DVHLSKDFVPVVYHDLTCCLTMKKKFEADPVELFEIPVKELTFDQLQLLKLTHVTALKSK
DVKESVVEEENSLSDNQPFPSLKMVLESLPEDVGYNIEIKWICQQRDGMWDGNLSTYFDM
NLFLDIILKTVLENSGNRRIVFSSFDADICTMVRHKQNKYPILFLTQGKSDIYPELMDLR
SRTTAIAMSFAQFENLLGINAHTEDLLRNPSYIEEAKAKGLVIFCWGDDTNDPENRKKLK
EFGVNGLIYDRIYDWMPEQPNIFQVEQLERLKQELPELKSCLCPTVSHFASSSLCEEPGI
HVDANGIDSMDSA
Download sequence
Identical sequences G1NZW5
ENSMLUP00000003024 ENSMLUP00000003024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]