SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003057 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000003057
Domain Number - Region: 358-422
Classification Level Classification E-value
Superfamily Influenza hemagglutinin (stalk) 0.00224
Family Influenza hemagglutinin (stalk) 0.0053
Further Details:      
 
Domain Number - Region: 457-606
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00439
Family BAR domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003057   Gene: ENSMLUG00000003354   Transcript: ENSMLUT00000003363
Sequence length 638
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429825:252547:286707:1 gene:ENSMLUG00000003354 transcript:ENSMLUT00000003363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRSSVSTGGAGRLSMQELRSQDFNKQGLYTPQTKEKPSFGKLNMTKPTSERKVSLFGKR
TSGTGSRNSQFGIFSVQDPRPLNDKAFIQQCIRLLCEFLTENGYAYNVSMKSLQAPSVKD
FLKIFTFLYGFLCPSYELPDTKFEEEVPRIFKGLGYPFALSKSSMYTVGAPHTWPHIVAA
LVWLIDCIKLHTAMKESSPLFDDGQPWGEETEDGIMYNKLFLDYTVKCYESFMTGADSFE
EMNAELQSKLKDLFNVDAFKLESLAAKNKALNEQIARLEQEREKEPNRLETLRKLKASLQ
ADVQKYQAYMSNLESHSAILDQKLNGLDEDISRIELECETMKQENTRLQNIVDNQKYSVA
DIERINHERNELQQTINKLTKELEDEQQQLWNEELKYARGKEAIETQLAEYHKLARKLKL
IPKGAENSKGYDFEIKFYPEAGANCLVKYRAQVYVPLKELLNQTEEESNKALNKKMGLDD
TLEQLNTMIMESRRSVRTLKEEIQKLDDLYQQKVKEAEEEDNKCANELESLEKHKHMLES
AVNEGLSETMNELDSIQREYQLVVQTTTEERRKVGNNLQCLLEMVATHVGSVEKHLEEQI
AKVDREYEEHVSEDLLENIREIGEKYKKKAALIKSSDD
Download sequence
Identical sequences G1NZZ3
ENSMLUP00000003057 ENSMLUP00000003057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]