SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003131 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003131
Domain Number 1 Region: 690-836
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.7e-40
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1015-1102
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.75e-29
Family Ras-binding domain, RBD 0.00095
Further Details:      
 
Domain Number 3 Region: 221-371
Classification Level Classification E-value
Superfamily PH domain-like 1e-21
Family Phosphotyrosine-binding domain (PTB) 0.0067
Further Details:      
 
Domain Number 4 Region: 12-100
Classification Level Classification E-value
Superfamily PDZ domain-like 1.46e-20
Family PDZ domain 0.0097
Further Details:      
 
Domain Number 5 Region: 960-1029
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000413
Family UBX domain 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003131   Gene: ENSMLUG00000003434   Transcript: ENSMLUT00000003441
Sequence length 1104
Comment pep:known_by_projection scaffold:Myoluc2.0:GL431230:634:46948:-1 gene:ENSMLUG00000003434 transcript:ENSMLUT00000003441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRAGDTVERPPPGTAPPRLRSVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRA
GDQILAVNEINVKKASHEDVVKLIGKCSGVLHMVVGEGLGHLESCSSDEEVGFYDGKGWR
KPRLDSKALGINRAERVVEDMQSGGIFSMIFENPRLHASSSEPSKLKHRSLSESAAARFD
PGQESVGGPQPGLLPKEIAHVINDDSVFSVGLENQDEFGLDASILNVAMVVGYLGSIELP
STSCSLEADSFQAIRGCLRRLRAEQKIHSLVTMKIMHDGVQLCTDKAAVLAEYPAEKLAF
SAVCPDDRRFFGLVTMQSSDDGSLAREGEGVLRTSCHVFMVDPDLFNHKIHQGIARRFGF
ECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEGVRARAFADGDADAHQNTSTSSN
SDSGIGNFNQEERNSRVLVVDLGASSSRHGPSSSTWEGAGGRGSQPWATPWNGAFCHDPE
AGPPFEAAPQADRGWDFSKHLGPTSHVEVPPTPLRSSVPPSKRGAVGPGGGFSQRWLPVH
VLQEWQCGHASDQESYTDSTDGWSSVNCGTLPPPMSKIPADRYRLEGSLAQPLLSTQKRD
WSRKAFGMQNIFGPHRNARKTKEDKKGSKFGRGLGLAQTSQRTSARRSFGRSKRFSVTRS
LDDLESATVSDGELNGADLKDCVSNHSLSSNASLPSVQSCRRLRERRVASWAVSFERLLQ
DPLGVRYFSDFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIFSTFLCSKATTP
VNIDSQAQLADDILSAPHPDMFKEQQLQIFNLMKFDSYTRFLKSPLYQECILAEVEGRSL
PDSQQVPSSPASKHSVSSDHSNVSTPKKLTGKSRSGRSLNEDLDEDSERKRKGVFFSWSR
TRSTGRSQKKKGHGDHTNDPPHANGGLGRRESQGSVSSAGSLDLSEACRTLAPERDKAAK
HCCIQLPDGTSCTVLVRAGLPIKEVLAGLCERHGINGAAVDLFLVGGDKPLVLHQDSSIL
ASRDLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLHLSELVARLSSER
EPLDLGAPISSLDGQRVILEEKEP
Download sequence
Identical sequences G1P061
ENSMLUP00000003131 ENSMLUP00000003131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]