SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003137 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003137
Domain Number 1 Region: 6845-6917
Classification Level Classification E-value
Superfamily SH3-domain 3.54e-17
Family SH3-domain 0.0000366
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003137   Gene: ENSMLUG00000003393   Transcript: ENSMLUT00000003448
Sequence length 6918
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430005:46928:237143:1 gene:ENSMLUG00000003393 transcript:ENSMLUT00000003448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADDEEYEEVVEYYTEETVYEEVPGETITEIYETTTTKTISDYDQSQPSKPGLAQPEAAK
PAERKKVIRKKVDSSKFMTPYIAHSRKMQDLFSINKYKENYEKGKGQPSTSTTDTPELRR
IKKVQDQLSEVKYRMDGDIAKTICHVDEKAKDIEHAKKVSQQVSKVLYKQNWEDNKDKYL
LPPDAPELVHAIKNTALFSKELYTEEWDADKSLFYPYHDSPELRRVAQAQKALSDIAYKK
GHIEQQTHFTSLADPPDIIFAKKVNDQASKLKYKQDYENKVKGKWSETPCFEIAAARTNA
DNFSTRKYHESFENMKDQIYFMQTETPEYKVNKQAGVAASKVKYKENYEKDKGKADYNVL
PASENPLLRQMMAAGNTLSDKRYKENYEKTKAKSINYCETPKFQLDAVLQKFSSDTKYKD
SYLKNILGHYVGSYEDPYYAHCMKVTAQNSDKNYRAEYEEDRGKGFFPQTITQEYETMKK
LDQCKDHTYKVHPDKTKFTQVTDSPVQLQAQINAKQLSDDFSPSINYKAKHESEKFKCHI
PPDTPAFIQHRVNAYNLSDNVYKHDWEKTKAKKFDIKVDAIPLLAAKANSKNASEVMYKK
DYEKNRGKMIGALSINDDPKMLHSLKTAKMQSDRLYKENYEKTKAKSMNYCETPKYQLDT
LLKTFSEAKYKDKYVQNILGHYIGSFEDPYQSHCMKVSAQNSEKNYKAEYEEDKGKCYFP
QTITQEYEAIKKLDQCKDHAYKLHPDKTKFTAVADTPVLLQAQLNTKQLSDLNYKAKHEG
EKFKCNVPADAPQFIQHRVNAYNLSDNVYKHDWEKTKAKKFDIKVDAIPLLAAKANSKNA
SEVMYKKDYEKNKGKMIGALSINDDPKMLHSLKTAKMQSDREYHKDYEKSKTIYTTPLDM
LQVTQAKKAQAIASDMDYKHVLHSYSYPPDSINLDLAKKAYALQSDVEYKADYNSWMKGC
GWVPYGSLEMEKAKRASDILNEKKYRQHPDTFKFTSIEDAPITVQSKINQAQRSDIAYKA
KGEKTLHKYSLPADLPQFIQAKVNAYNISENIYKADLKDMSKKGYDLRTDAIPIKAAKAA
RQAASDVQYKKDYEKAKGKMVGFQSLQDDPKLVHYMNVAKIQSDRVYKNDYEKTKTKFNI
PHDMFNVVAAKKAQDIVSNTNYKHPLHHYTYLPDAMDLELSKNMMHIQSDNAYKEDYNTW
MKGIGWIPIGSLDVEKVKKAGDALSEKKYRQHPDTLKFTSIVDSPVMVQAKQNTQQVSDI
LYKAKGEDVKHKYTMSSDLPQFLQAKCNAYNISDVCYKRDWHDLIAKGNNVLGDAIPITA
AKASRNIASDYKYKEAYEKAKGKHVGFRSLQDDPKLVHYMNVAKLQSDREYRKNYENTKT
SYHTPGDMVSITAAKMAQDVVTNINYKQPIHHYTYLPDAMSVQHTRNANQIQSDNVYKDD
YNTFFKGIGWIPIGSLEVEKAKKAGDALNERKYRQHPDTIKFTSVPDSMGMVLAQQNTKQ
LSDLNYKVEGEKLKHKYTIDPELPQFIQAKVNALNMSDAYYKADWKKTLAKGYDLRTDAI
PIVAAKSSRNIASDFKYKEAHEKAKGKQIGFRSLQDDPKLVHYMNVAKMQSEREYKKGYE
ASKTRYHTPLDMFSVTAAKKSQEVATNTNYRQPFHNYTLLPDAMNVEHSKNAMQIQSDNL
YKSDFTNWMKGIGWVPIDSLEVEKAKKAGEILSERKYRQHPEKLKFTYSMDTMEQELNKS
NKLTMDKRRYIEKWNKDKTTIHIMPDTPDILLSKMNQITMSDKLYKAGWEEEKKKGYDLR
PDAISIKAAKASRDIASDFKYKQAYEQGKGKHIGFRSLEDDPKLVHFMQVAKMQSDREYR
KGYEKSKTSFHTPVDMFSVVAAKKSQEVASNTNYRNVIHTYNMLPDAMNFELAKNMMQIQ
SDNQYKADFDDFMKGVGWLPLGSLEAEKNKKAMEIISEKKYRQHPDTLKYSTLMDSMNMV
LAQNNAKIMNEHLYKQAWEADKTKIHIMPDIPQIILAKANAVNMSDKLYKLSMEESKKKG
YDLRTDAISIKAAKASRDIASDYKYKYNYEKERGKMVGFRSLEDDPKLVHSMQVAKMQSD
REYKKNYEKTKTSYHTPPNMLSVTAAKDAQTNISNTNYKHLIHKYILLPDAMSIQLSKNM
NHIQSDNEYKQDYNEWYKGLGWSPAGSLEVEKAKKATEYASDQKYRQHPSTFQFKKLTDS
MDMVLAKQNALTMNKQLYTVDWNKDKTKIHLMPDTPDILQAKQNQTIYSQKLYKLGWEEA
LKKGYDLPVDAISVQLAKASRDIASDFKYKQGYRKQLGHHIGFRSLQDDPKLVLSMNVAK
MQSDREYKKDFEKWKTKYTSPVDMLGVVLAKKCQALVSDVDYKNYLHQWTCLPDQNDVIQ
AKKVYEIQSENLYKSDLEWLRGIGWSPLGSLEAEKNKRASEIISEKKYRQPADKNKFTSI
PDAMDVVLAKANAKNRSDRLYREAWDKDKTQVHIMPDTPDIMLAKANLINTSDKLYRMGY
EELKKKGYDLPLDAISVKAAKASREIASEYKYKEGFRKQLGHHIGARDIKDDPKMMWSLH
VAKIQSDREYKKDFEKSKTRYSSPVDMLGVVLAKKCQTLVSDVDYKNYLHQWTCLPDQND
VIHARQAYDLQSDNLYKADLQWLKGIGWLPSGSLEDEKNKRAMQILSEHVYRQHPDKFKF
TSLMDSMPMVLAKNNAITMNHRLYTEAWDKDKTSIHIMPDTPEVLLAKQNKINYSEKLYK
LGLEEAKRKGYDMRLDAIPIKAAKASRDIASEFKYKEGYRKQLGHHIGARDIKDDPKMMW
SLHVAKIQSDREYKKDFEKSKTRFSSPVDMLGVVLAKKCQTLVSDVDYKNYLHQWTCLPD
QNDVIHARQAYEIQSDNMYKSDLQWMRGIGWVPIGSLDVEKCKKATEILSDKIYRQHPDQ
FKFTSVTDSLEQVLAKNNAITMNKRLYTEAWDKDKTQIHIMPDTPEITLARMNKINYSES
LYKLANEEAKKKGYDLRSDAIPIVAAKASRDIASDYKYKDGYRKQLGHHIGARDIKDDPK
MLWSMHVAKIQSDREYKKDFEKSKTRYSSPVDMLGVVLAKKCQTLVSDVDYKNYLHQWTC
LPDQNDVIHARQAYEIQSDNVYKSDLQWLRGVGWVPIGSLDVLKCKRATEILSDNIYRQP
PDKQKFTSVTDSLEQVLAKNNAITMNKRLYTEAWNKDKTQIHVMPDTPEIMLAKQNQLNY
SETLYKLANEEAKKKGYDLRSDAIPIVAAKASRDIVSDYKYKDGYRKQLGHHIGARNIKD
DPKMMWSMHVAKIQSDREYKKDFEKSKTRFSSPVDMLGVVLAKKCQTLVSDVDYKNYLHQ
WTCLPDQNDVIHARQAYEIQSDNMYKSDLQWMRGIGWVPIGSLDVVKCKRAAEILSDNIY
RQPPDKQKFTSVTDSLEQVLAKNNAITMNKRLYTEAWDKDKTQIHIMPDTPEIMLARQNK
INYSESLYRQAMEEAKKEGYDLRSDAISIVAAKASRDIASDYKYKEAYRKQLGHHIGARA
IHDDPKMMWSLHIAKVLSNLEYKKEFEKYKTRYSSPVDMLGIVLAKKCQTLVSDVDYKHL
LHEWTCLPDQNDVIHARKAYDLQSDNLYKSDLEWMKGIGWVPIGSLEVVKAKRATEILSD
NIYRQRPDALKFTSITDTPEQVLAKSNAINMNKRLYTEAWDNDKKTIHVMPDTPEIMLAK
LNRINYSDKLYKLALEESRKEGYDLRVDAIPIQAAKASRDIASEYKYKEGYRKQLGHHIG
ARNIKDDPKMMWSMHVAKIQSDREYKKDFEKSKTKYSSPVDMLGVVLAKKCQILVSDIDY
KHPLHEWTCLPDQNDVIQARKAYDLQSDAIYKADLEWLRGIGWVPIGSVEVEKVKRAGEI
LSDRKYRLPADKLKFTCITDTPEIVLAKSNALTMSKHLYTEAWDADKTSIHVMPDTPEIM
LAKSNSVNISQKLYTKGWDESKMKDYDLRADAISIKSAKASRDIASDYKYKEAYEKQKGH
HIGAQSIEDDPKIMCAINAGKIQSEREYKKDFEKSKTKYSTPVDMLGILLAKKCQTLVSD
IDYRNILHHWTCLPDQNDIIQAKRAYELQSDAIYKADLEWLRGIGWMPDGSPEVLRVKNA
QEILRDSVYRTPVVNLKYTSIVDTPEVVLAKSNAENISIPKYREVWDKDKTSIHIMPDTP
EINLARANALNVSNKIYREGWDEMKMSCDVRLDAIPIQSAKASREIASDYKYKLDHEKQK
GHYVGTLTARDDNRIRWALIAGKLQNEREYRLNWAKYKTKFQSPVDMLSILHSKNCQVLV
SDIDYRQRLHQWTCLPDQNDVIQAKKAYELQSDAIYKADLEWLRGIGWMPNDSVSVNHAK
YAGDIFSENKYRTKIESLNFTPVDDRVDYVTAKQSGEILNDIKYRKDWNDTKSKYTLTET
PLLHTAQEAARILDQYLYKEGWEKQKATGYILPPDAVPFVHAHHSSDVQSELKYKAEHVK
QKGHYVGVPTMRDDPHLVWFEHAGQIQNDRLYKEDYHKTKAKINIPADTVSVLAAKQGQS
LISDIDYRNYLHQWTCHPDQNDVIQAKKAYELQSDNVYKSDLEWLRGIGWIPLDSVDHVR
VTKNQEMVNQVKYKKAALDNYPNFTSVEDPPEIVLAKINSVNQSDIKYKETFNKLIKGKY
IFSPETPYITHSRDMGKLHSTILYKGAWEGTKAYGYTLDERYIPIVGAKHADYVNSELKY
KETFEKQKGHYLAGKEISEFPGVVHCLDFQKMRSALNYRKHYEDTKANIHIPNDMMNHVL
AKKCQYILSDLEYRHYFHQWTSLPEEPSILLARNAQEILSDNVYKDDLNWLKGIGCYVWD
TPQILQAKKSYDLQSQIQYTAASKDNLQNYSLVTDTPVYVTALQSGINASEVRYKENYHQ
IKDKYTTVLETVDYDRTKNLKNLYSSNLYKEAWEKVKATSYILPSSTMSLTHAKNQKDLA
SNIKYREEYEKFKALYTLPRSVEDDPNTARCLRVGKYNIDRLYKSVYEKNKMKINIVPDM
VEMVTAKDSQKKVSEIDYRLHLHEWICHPDLQVNSHVRKVTDQISDIVYKDDLNWLKGIG
CYVWDTPEILHAKHAYDLRNDIKYQAHVKKTRNDYNLVMDTPVYVQAVQSRKQISDAVYH
YDYVHSVRGKVAPTTKTVDLDRALHAYKLQSENLYRDAGKRSLATGYRLPVDTPNFKHSK
DTQYMSSYFKYKEVYEHLKANGYTLGPNDVPFVNVRRVNNVTSERLYRQLYHKLKDKIHT
TPDTPELRQVKKTQEAVSELIYKSDFFKMQGHMISLPYTPQVLHCRYVGDITSDIKYKED
LQILKGMGCFLMDTPDMVRSRFLRKLWSNYLYTDNARKMRDKYKVVLDTPEYRTVQELKT
HLSELVYRAKGKKQKSIFTSIPDTPDLLRAKQGQKLQSQYLYVELATKERPHHHAGNQTT
ALKHAKDVKDLVSENKYKIQYEKMKDKYTPIPDTPVLIRAKKAYWNASDLRYKETFEKTK
GKYHTVKDALDIVYHRRVTDDISKVKYKENYMSQLGIWRSIPDSPEHFHHQAVRDAVSDV
KYKEDLTWLKGIGCYAYDTPDFTLAEQNKTLYSKYKYKEIFERTKSNFKYEADCPINRHF
KYATQLMNEKKYRADYHQRKDKYHLVVDEPRHLLAKIAGDQISQIKYRKKYEKSKDKFTS
IVDTPEHLRTTKVNKQISDILYKLEYNKAKPRGYTTIHDTPMLLHVRKVKDEVSDLKYKE
VYQRNKSNCTIKPDAVHIKAAKDAYKVNTNLDYKKLYEANKAHWRWIPDRPDFLQAAKSS
LQQSDFEYKLDREFLKGCKLSVTDDKDMVLALRNSLIESDLKYKEKHVKERGSCHAVPDT
PQILLAKAVSHLVSENKYKDYVKKHLAQGSYTTLPETPNTIRVKEVTKHVSDTNYKKKFV
KEKGKSNYSIMMEPPDVKHAMEVAKKQSDVAYRKDAKENLHYTTVADRPDIKKATQAAKQ
ASEVEYRAKHRKEGSHGLSMLGRPDIEMAKKAAKLSSQIKYRENFDKEKGKTPKYNPKDS
QLYKVMKDANNLASEVVKYKADLKKLHKPVTDMKESLIMNHVLNTSQLASSYQYKKKYEK
SKGHYHTIPDNLEQLHLKEATELQSIVKYKEKYEKERGKPMLDFETPTYLTAKESQQMQS
GKEYRKEYDESIKGRNLTGLEVTPASLHAKYATKIISEKEYRRDLEESIRGKGLHEMEDT
PDMIRAKNATQILNEKEYKRDLELGVKGKGLNAMANETPDFMRAKNATDIASQIKYKHSA
EMEKANFTSVVDTPEIIHAQQVKNLSSQKKYKEDAEKSMSSYETVLDTPEMQRVRENQKN
FSLLQYQCDLKNSKGKITVVQDTPEILRVKENQKNFSSVLYKEDPSPGTAIGKTPEMMRV
KQTQDHISSVKYKEAIGQGTPISDLPEVKRVKETQKHISSVMYKENLGTGIPTSVTPEIE
RVKRNQENFSSVLYKENLGTGTPTPITPEMERVKRNQENVSSILYKENLNKGTPIPVTPE
MERVKRNQENFSSVLYKENMGKATPTPVTPEMQRVKRNQENISSVLYKDNLGKATPTPFT
PEMERVKRNQENFSSVLYKENMRKATPTPVTPEMERAKRNQENISSVLYSDSFRKQIQGK
AAYVLDTPEMRRVRETQRHISTVKYHEDFEKHKGCFTPVVTDPITERVKKNTQDFSDINY
RGIQRKVVQMEQKRNDQDQETITGLRVWRTNPGSVFDYDPAEDNIQSRSLHMINAQAQRR
SREQSRSASALSVSGGEEKSEHSEGADHHLSTYSNGGIFFSATSTAYKHAKTTELPQQRS
SSVATQQTTVSSIPSHPSTAGKIFRAMYDYMAADADEVSFKDGDAIVNVQAIDEGWMYGT
VQRTGRTGMLPANYVEAI
Download sequence
Identical sequences G1P067
ENSMLUP00000003137 ENSMLUP00000003137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]