SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003153 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003153
Domain Number 1 Region: 851-968
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000011
Family PDZ domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003153   Gene: ENSMLUG00000003447   Transcript: ENSMLUT00000003464
Sequence length 1552
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429791:10495464:10558253:-1 gene:ENSMLUG00000003447 transcript:ENSMLUT00000003464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RQEETDRRVKNVLITLYWLGRKAQSNPYYNGPYLNLKAFENLLGQALTKALEDSSCLKRS
GRDSGYGDIWCADRGEFPVPPGSHRREDSFESLDSLGSRSFTSCSSDITLRGGREGCESD
TDSEFTFKMQEYNKDDMSYRRISAIEPKSALPFNRFLPNKSRQPSYVPAPLRKKKPDRHE
DNRRSWASPVGTEADGTFPSNERRTWGTHVENWTAVQETSDSFCYLEEEEERTSIPDTVK
DDLYVRKLSPIMPNPGNTFDQFLPKCWIPEDVNWKRIKRETYKPWYKEFQGFSPFLLLQA
LQTYSDDILSSETNIKLDPTAGPRLITRRRHLSYAPGYRRGDLEMSALDPDLENDDFFVR
KTGAFHANPCVLRAFEDFRRFSGRDDPVERDIILQCREGELVLPDLEKDDMIVRRIPAQK
KEVPLSGAPDRYQPIPFPEPWTLPPEIQAKFLCVLERTCPSKEKSNSCRVLVPSYRQKTD
DMLTRKIQYWKLGTSVPPISFIPGPCSEADLRKWEAIREASRLRHRKRLMVERLFQKIYG
ENGSKSMSDVSAEDVQNLRQLRYEEMQKMKSQLKEQDQKWQDDLAKWKDRRKSYTSDLQK
KKEEREEIEKQALEKSEKSSKTFKEMLQDRGSRNETSTITSRSRIYSSDDVLSEDKLPLT
LTMSEASHQGERVEEKGTTYPTEIPKQDSTTVVKREDTLPAEVRLPSKSPTEEQRPASLS
SQRSLTTQMESTRVSASLPRSYQKTDTARLTSVVTPRPFGSHSRGISSLPRSYTMDDVWK
YNGDVEGVKRTQYSSVSTSVQTSDPSQLASSSFGEIEAVTSGEGVMRLPSPTPPFSSLSQ
DWAATSNATWSSVSGPNSMSDLGEGRSSPQTEVSRSKDQFSDMRISINQTPGNGLDFGFT
VKWDISGIFIASVEAGSPAEFSQLQVDDEIIAINNTKFSYKDTKEWEEAMANAQETGNLV
MDIRRYGKSGSPETKWIDATSGIYNSDRSSNLSIMTDFSESLQNSNTESKEINGIRDESS
TFELKASEPISLKNLKRRSQFFEQGSSDSVVPDLPVPTISAPSRWAWDQEEERKRQERWQ
KEQDRLLQEKYQREQEKLREEWQRAQQEAERENDKFLNEELMVLNSNITALTTREPTVAT
LEATWDEGSKSSDREGTRAGEEGRRQWHEEEMIEDQKEQQYEEEQEEMRRQAEAEEQKRY
AEEQKLQAEEQKRQAEEQKRQAEEQKRQAEEQKRQAEEQKRQAEEQKRRTEEQMHQAERE
RETSVRIYQYRRPVDSYDIPKGEEESSGLLPSDRNKSRSTTELDDFSTIKNGSHKYLDRV
GNGSSTQRSAKKEPGPSGAELERQQILQEMRKKTSLHTDSSWIRQRSSSINKEPICLPGI
MRRGESLDNLESPRSSSWRQSPWLSQSTGVYASSSVQDFSRPPPQLVSTSNRAYMRNPSS
SVPPPAAGPVKTSPAPSPTPRSHFPSTSPSQPRNRSVSGKRVCSYCHNILGKGAAMIIES
LGLCYHLYCFKCVACECDLGGSSSGAEVRIRNNQLYCNNCYLRLKSGRPTAM
Download sequence
Identical sequences G1P080
ENSMLUP00000003153 ENSMLUP00000003153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]