SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003159 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003159
Domain Number 1 Region: 168-353
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.21e-49
Family Nucleotide and nucleoside kinases 0.0000000144
Further Details:      
 
Domain Number 2 Region: 24-167
Classification Level Classification E-value
Superfamily SH3-domain 5.12e-44
Family SH3-domain 0.0000000934
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003159   Gene: ENSMLUG00000003465   Transcript: ENSMLUT00000003470
Sequence length 471
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429856:4367724:4592515:1 gene:ENSMLUG00000003465 transcript:ENSMLUT00000003470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSADSYTSRPSDSDVSLEEDREAIRQEREQQAAIQLERAKSKPVAFAVKTNVSYCGALDE
DVPVPSTAISFDAKDFLHIKEKYNNDWWIGRLVKEGCEIGFIPSPLRLENIRIQQEQKRG
RFHGGKSSGNSSSSLGEMVSGTFRATPTSAAKQKQKVTEHIPPYDVVPSMRPVVLVGPSL
KGYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKRAIIERSNTRSSL
AEVQSEIERIFELARSLQLVVLDADTINHPAQLIKTSLAPIIVHVKVSSPKVLQRLIKSR
GKSQSKHLNVQLVAADKLAQCPPEMFDVILDENQLEDACEHLGEYLEAYWRATHTTSSTP
MTPLLGRNLGSTALSPYPTAISGLQSQRVRHSNHSTENSPIERRSLMTSDENYHNERARK
SRNRLSSSSQHSRDHYPLVEEDYPDSYQDSYKPHRNRGSPGGYSHDSRHRL
Download sequence
Identical sequences G1P084
ENSMLUP00000003159 ENSMLUP00000003159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]