SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003166 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003166
Domain Number 1 Region: 7-145
Classification Level Classification E-value
Superfamily ENTH/VHS domain 6.02e-49
Family VHS domain 0.00015
Further Details:      
 
Domain Number 2 Region: 199-273
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-21
Family SH3-domain 0.0000553
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003166   Gene: ENSMLUG00000003477   Transcript: ENSMLUT00000003478
Sequence length 533
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429856:4318556:4353282:1 gene:ENSMLUG00000003477 transcript:ENSMLUT00000003478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLFAANPFEQDVEKATNEYNTTEDWSLIMDICDKVGSTPNGAKDCLKAIMKRVNHKVPH
VALQALTLLEACVANCGKIFHLEVCSRDFATEVRAVIKNKAHPKVCEKLKSLMVEWSEEF
QKDPQFSLISATIKSMKEEGITFPPTGSQISMFVHLQTVSTAAKNGTSSNKNKEDEDIAK
AIELSLQEQKQQHTETKSLYPSAEVQLNNKVARKVRALYDFEAVEDNELTFKHGEIIIVL
DDSDANWWKGENHRGIGLFPSNFVTTNLNMESEAAAVDKLNVIDDEEEEIKISEPEPVYI
DEDKMDRALQVLQSIDPADSKPDSQDLLDLEGICQQMGPMIDEKLEEIDRKHSELSELNV
KVLEALELYNKLVNEAPVYSVYSKLHPPAHYPPSSAGVPMQTYPIQSHGGNYMGQSIHQV
TAAQSYSLGPDQIGPLRSLPPNVNSSVTTQPAQAPYMSPGQDPVSNPTYMNQNSALPSAA
GTAAYTQQMGMSVDLSSYQNTAASLPQLAGFPMAVPAHAMAQQQTNYHQQPLL
Download sequence
Identical sequences G1P091
ENSMLUP00000003166 ENSMLUP00000003166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]