SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003171 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003171
Domain Number 1 Region: 297-499
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.1e-30
Family Phospholipase D 0.022
Further Details:      
 
Domain Number 2 Region: 751-942
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 6.08e-27
Family Nuclease 0.036
Further Details:      
 
Domain Number 3 Region: 78-212
Classification Level Classification E-value
Superfamily PX domain 8.9e-16
Family PX domain 0.0061
Further Details:      
 
Domain Number 4 Region: 223-326
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000134
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 5 Region: 667-723
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.000000118
Family Phospholipase D 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003171   Gene: ENSMLUG00000003478   Transcript: ENSMLUT00000003484
Sequence length 962
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429820:1162807:1261228:1 gene:ENSMLUG00000003478 transcript:ENSMLUT00000003484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLKTEPIVNISALQKIAADMSNLIENLDTRELHFEGEEVDYDVSPSDPKTQEVYIPFSA
IYKTQGFKEPNVQTYLSGCPIKAQVLEVERFTSTTRARSINLYTIELTHGEFKWQVKRKF
KHFEEFHRELLKYKAFIRIPIPTRRHTFRRQNVKEEPREMPSLPRSSENTMKEEQFLGRR
KQLEDYLTKLLKMPMYRNYHATTEFLDISQLSFIHDLGPKGIEGMIMKRSGGHRIPGLNC
CGQGRACYRWSRRWLIVKDSFLLYMKPDNGAIAFVLLVDKEFRIKVGKKETDTKYGLRID
NLSRTLILKCNSYRHARLWAGAIEEFVQKYGSNFLKDHRFGSYATLQENILAKWYVNAKG
YFEDIANAMEEAKEEIFITDWWLSPEIFLKRPVVEGNRWRLDYILKRKAQEGVRIFIILY
KEVELALGINSEYSKKTLMRLHPNIKVMRHPDHVSSAVYLWAHHEKLVIIDQSVAFVGGI
DLAYGRWDDNEHRLTDVGSVKRVISGPSLCSLPAEITESMESLSLKDKKESAKNLPILKT
ADDMDSKLKGIGKPSKFSKFSLYRQLHRHHLHGSDSLSSIDSASSYCNHCRSRQNLIHGL
KPHLKLFRSSSGSEQGLPRPAIDTGSVRSLQTGVGELHGETRFWHGKDYCNFVFKDWIQL
DKPFADFIDRYSTPRMPWHDIGSVVHGKAARDVARHFIQRWNFTKIMKPKYRSLSYPFLL
PKSHTTAHELKYQVPGSVRANVQSVLPSATDWSAGIKYHEESIHTAYVHVIENSKHYIYI
ENQFFISCADDKVVFNKIGDAIAQRILRAYREGRRYRVYVVIPLLPGFEGDIKTGGGNAL
QAIMHFNFRTMCRGENSILGQLKVELGNQWINYISFCGLRTHAELEGNLVTELIYVHSKL
LIADDNTVIIGSANINDRSMLGKRDSEVAVIVQDTETVPSVMDGEEYQAGRFARGLRLQC
FR
Download sequence
Identical sequences G1P096
ENSMLUP00000003171 ENSMLUP00000003171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]