SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003210 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003210
Domain Number 1 Region: 234-293
Classification Level Classification E-value
Superfamily SH3-domain 3.81e-21
Family SH3-domain 0.00059
Further Details:      
 
Domain Number 2 Region: 47-109
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.68e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000003210
Domain Number - Region: 295-349
Classification Level Classification E-value
Superfamily SH3-domain 0.0011
Family SH3-domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003210   Gene: ENSMLUG00000003520   Transcript: ENSMLUT00000003527
Sequence length 351
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429962:1220626:1282352:1 gene:ENSMLUG00000003520 transcript:ENSMLUT00000003527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLQKLKRSLSFKTKSLRSKSADNFFQRTNSDVKLPGDMLAEVSPAQPLPPRADVHAHRLA
EHIFKKPTFCDVCNHMIVGTNAKHGLRCKACKMSIHHKCMDGLAPQRCMGKLPKGFRRYY
SSPLLIHEQFGCIKEVMPIACGNKVDPVYEALRFGTSLAQRTKKSSSGSGSDSPHRTSTS
DLVEVPEEADGPGDGYDLRKRSNSVFTYPENGTDDLRDQAKNLNHQGPLSKDALQMNTYV
ALYKFVPQENEDLEMRPGDMITLLEDSNEDWWKGKIQDRIGFFPANFVQRVQQNEKIFRC
VRTFIGCKEQGQITLKENQICLTSEEEQDGFIRVLSGKKRGLVPLDVLENV
Download sequence
Identical sequences G1P0D4
ENSMLUP00000003210 ENSMLUP00000003210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]