SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003236 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000003236
Domain Number - Region: 150-235
Classification Level Classification E-value
Superfamily PH domain-like 0.00123
Family TFIIH domain 0.029
Further Details:      
 
Domain Number - Region: 22-81
Classification Level Classification E-value
Superfamily PH domain-like 0.00523
Family GRAM domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003236   Gene: ENSMLUG00000003551   Transcript: ENSMLUT00000003554
Sequence length 341
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429772:11906669:11933107:-1 gene:ENSMLUG00000003551 transcript:ENSMLUT00000003554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVLDALWEDRDVRFDVSPQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRIIWH
SLALPRVNLSIGYNCILNITTRTANSKLRGQTEALYILTKCNSTRFEFIFTNLIPGSPRL
FTSVIAVHRAYETSKMYRDFKLRSALIQNKELRLLPQEHVYDKINGVWNLSSDQGNLGTF
FITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPV
EKLQASVKEINSLHKVYSASPIFGVDYEMEEKPQPLEALTVEQIQDDVEIDSDDHPDAFV
AYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLWEVMS
Download sequence
Identical sequences G1P0F6
XP_014301037.1.53796 ENSMLUP00000003236 ENSMLUP00000003236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]