SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003245 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003245
Domain Number 1 Region: 14-185
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.37e-61
Family Cyclophilin (peptidylprolyl isomerase) 0.0000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003245   Gene: ENSMLUG00000003562   Transcript: ENSMLUT00000003564
Sequence length 313
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429767:45007168:45042397:-1 gene:ENSMLUG00000003562 transcript:ENSMLUT00000003564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNIYIQEPPTNGKVLLKTTAGDIDIELWSKEAPKACRNFIQLCLEAYYDKTIFHRVVPG
FIVQGGDPTGTGTGGESIYGAPFKDEFHSRLRFNRRGLVAMANAGPHDNGSQFFFTLGRA
DELNNKHTIFGKITGDTIYNMLRLAEVDTDNEERPLNPHRIKSCEVLFNPFDDIIPREIK
KLKKEKPEEKVKTLKPKGTKNFSLLSFGEEAEEEEEEVNRVSQSMKGKSKSSHDLLKDDP
HLSSVPVVESEKGDAAGDLDDDEEFEGAENDENIDGDEKNLMRERIAKKLKKDPSASVKS
AGEGEGEKKSVSR
Download sequence
Identical sequences G1P0G4
ENSMLUP00000003245 ENSMLUP00000003245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]