SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003273 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003273
Domain Number 1 Region: 434-672,707-747
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 2.62e-42
Family Diacylglycerol kinase-like 0.023
Further Details:      
 
Domain Number 2 Region: 7-102,130-157
Classification Level Classification E-value
Superfamily EF-hand 2.72e-39
Family EF-hand modules in multidomain proteins 0.0000111
Further Details:      
 
Domain Number 3 Region: 132-222
Classification Level Classification E-value
Superfamily EF-hand 2.61e-17
Family Calmodulin-like 0.018
Further Details:      
 
Domain Number 4 Region: 225-291
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000419
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.014
Further Details:      
 
Domain Number 5 Region: 295-363
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000508
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003273   Gene: ENSMLUG00000003590   Transcript: ENSMLUT00000003595
Sequence length 748
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429886:3535935:3549824:-1 gene:ENSMLUG00000003590 transcript:ENSMLUT00000003595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVKKRKMAKERGLMSPNDFAQLQKYMEYSTKKVSDVLKLFEDGEMAGYVQEDTKQEILAI
GYEGFQQFLKIYLEVDDVPSHLSLALFQSFQTSYSLEETVKKEGKLKGRVGTNKGKEKSQ
SEGTPNFLYPDMVCLSDVSCYFSLLEGGRPEDKLEFTFKLYDMDRNGILDSSEVEKIITQ
MMRVAEYLDWDVSELKPILQEMMKEIDYDGSGSVSLAEWLRAGATTVPLLVLLGLEMTLK
DNGQHMWRPKRFPRPVYCNLCESSIGLGKQGLCCNLCKYTVHDQCAMKALPCEVSTYAKS
RKDIGVQSHVWVRGGCVSGRCDRCQKKIRIYHGLVGLHCVWCHLEIHDDCLQAVGHECDC
GLLRDHILPPSSIYPSVLVSAVASGQEHKSTKTSQKIVDDLNLSTVHLNSNKTLCSLSLF
SSPVQIDPVANTHPLLVFVNPKSGGKQGERVLWKFQYLLNPRQVFNLLKDGPEPGLRFFR
EVPDYRILVCGGDGTVGWILETIDKANLPVVPPVAVLPLGTGNDLARCLRWGGGYEGQNL
GKILKDLETSKVVHMDRWSVEVIPQRTEEKCDPVPFQIINNYFSIGVDASIAHRFHMMRE
KYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSSLSLEGIAVLNI
PSTHGGSNLWGDTKRPHGDIHGINQALGSAAKVITDPDILKTSVPAPDPSDKRLEVVGLE
GAIEMGQIYTKLKNAGRRLAKCSEITFQ
Download sequence
Identical sequences G1P0J0
ENSMLUP00000003273 ENSMLUP00000003273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]