SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003276 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003276
Domain Number 1 Region: 9-134
Classification Level Classification E-value
Superfamily PH domain-like 1.06e-40
Family Phosphotyrosine-binding domain (PTB) 0.000000393
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003276   Gene: ENSMLUG00000003598   Transcript: ENSMLUT00000003598
Sequence length 508
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429923:2873619:2879696:-1 gene:ENSMLUG00000003598 transcript:ENSMLUT00000003598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTETELILYTRKRDSVKWHYL
CLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNSINVVEEPVVER
SNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNCAAVHVPLEARISNAESNTPKEEPSSIEDRDP
QILLEPEVVRFVLGPTPVQKQLMEKEKLEKIGRDQVSGSGANNTEWDTGYDSDERRDAPS
VNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCIPTVF
NFDIRRPSLEHRQLNYIQVDLEGGSDSDNPQTPKTPTTPLPQTPTRRTELYAVIDIEKTA
AMSNLQKALPRDDGTSRKTRHNSTDLPM
Download sequence
Identical sequences G1P0J3
XP_014316993.1.53796 XP_014316994.1.53796 XP_014316996.1.53796 XP_014316997.1.53796 XP_014316998.1.53796 XP_014316999.1.53796 XP_014317000.1.53796 XP_014394251.1.60319 XP_014394257.1.60319 XP_014394260.1.60319 XP_014394269.1.60319 XP_014394276.1.60319 XP_014394281.1.60319 XP_015422314.1.95426 XP_015422315.1.95426 XP_015422316.1.95426 XP_015422317.1.95426 XP_015422318.1.95426 ENSMLUP00000003276 ENSMLUP00000003276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]