SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003278 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003278
Domain Number 1 Region: 14-123
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-22
Family Spermadhesin, CUB domain 0.00085
Further Details:      
 
Domain Number 2 Region: 200-302
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 4.01e-20
Family Platelet-derived growth factor-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003278   Gene: ENSMLUG00000003599   Transcript: ENSMLUT00000003600
Sequence length 309
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429768:28451632:28535573:1 gene:ENSMLUG00000003599 transcript:ENSMLUT00000003600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVQAPQHERIITVSTNGSIHSPKFPHTYPRNMVLVWRLVAAEENVWIQLTFDERFGLEEP
EDDICKYDFVEVEDPSDGTILGRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIH
YNIVMPQVTEAVSPSVLPPSALPLDQLNNAVTAFSTLEDLIRYLEPDRWQLDLEDLYRPG
WQLLGKAFVFGRKSRGHAVVDLNLLKEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLL
VKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKIGVRGLHKSLTDVALEHHEECD
CVCRGNTGG
Download sequence
Identical sequences G1P0J5
ENSMLUP00000003278 ENSMLUP00000003278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]