SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003344 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003344
Domain Number 1 Region: 26-95
Classification Level Classification E-value
Superfamily PDZ domain-like 7.76e-18
Family PDZ domain 0.0013
Further Details:      
 
Domain Number 2 Region: 286-315
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000563
Family LIM domain 0.001
Further Details:      
 
Domain Number 3 Region: 253-285
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000156
Family LIM domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003344   Gene: ENSMLUG00000003674   Transcript: ENSMLUT00000003671
Sequence length 330
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429833:3319647:3341189:1 gene:ENSMLUG00000003674 transcript:ENSMLUT00000003671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLVKQPPIGDDPNHSQLLGWEEMNQLPFLITKVTPGSKAAIANLCIGDIITAIDGENTS
NMTHLEAQNKIKGCVDNMTLTVSRSEHKVWSPLVTEEGKRHPYKMNLASEPQEVLHIGSA
HNRSAMPFTASPASGSAPRVITNQYNNPSGLYSSENISNFNSALEAKTAAGGPETNGRGL
EHSQSPSGLVIDKESEVYKMLQEKQELNEPPKQSTSFLVLQEILESEEKGDPNKPSGFRS
VKAPVTKVAASIGNAQKLPMCDKCGTGIVGVFVKLRDHHRHPECYVCTDCGTNLKQKGHF
FVEDQIYCEKHARERVTPPEGYDVVTVFPK
Download sequence
Identical sequences G1P0Q0
ENSMLUP00000003344 ENSMLUP00000003344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]