SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003371 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003371
Domain Number 1 Region: 284-469
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.5e-68
Family SPRY domain 0.0000000297
Further Details:      
 
Domain Number 2 Region: 13-83
Classification Level Classification E-value
Superfamily RING/U-box 4.57e-23
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 3 Region: 92-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.53e-16
Family B-box zinc-binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003371   Gene: ENSMLUG00000003700   Transcript: ENSMLUT00000003702
Sequence length 471
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429905:1827724:1833262:-1 gene:ENSMLUG00000003700 transcript:ENSMLUT00000003702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EHPAMASAKPLAMMWEEVTCPICLDPTVEPVSIECGHSFCQECISQVAKAGGGTCPVCRK
QFLLKNFRPNLQLANMVDNLRQISQNAKEGTQKEQCGVHGERLLLFCERDEKALCLVCSQ
SRKHRDHPVVPLEEAAQEYQEKLQVALKKLRKEQELAEKLEMDVVTKRAAWKEKVETHKL
RIHAEFEQQKNFLAEEKQRQLQKLEKEEREQLRILGETEAKLAQRCQALQELVSELERRS
RGSELELLQEVKSVLQRSESWKLGELDITSPDLRTVCLVPGLKSMLRMCGVHITLDPHTA
NPWLIISEDKRQVRLGDTQQKVPENEERFDTYPMVLGAQCFDSGKRYWEVDVTGKEAWDL
GVCRDSVQRKGHFILSPMNGFWTIWLWKKEKYEAGTCPQTPLHLSVPPCQIGIFLDYEAR
TVSFYNITDHGSLIYTFSECAFTGPLRPFFNPGFDDGGRNSAPLTLCPLRM
Download sequence
Identical sequences G1P0S5
ENSMLUP00000003371 ENSMLUP00000003371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]