SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003437 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003437
Domain Number 1 Region: 1-179
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.77e-45
Family IMD domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003437   Gene: ENSMLUG00000003769   Transcript: ENSMLUT00000003772
Sequence length 687
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429794:3925028:3952540:1 gene:ENSMLUG00000003769 transcript:ENSMLUT00000003772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSALTRMCMRMCMRHRSRSLQSILRTSKSALIDCLINPLQEQMEEWKKVANQLDKDHAKE
YKKARQEIKKKSSDTLKLQKKAKKGRGDIQPQLDSALQDVNDKYLLLEETEKQAVRKALI
EERGRFCTFISMLRPVIEEEISMLGEITHLQTISEDLKSLTMDPHKLPSSSEQVILDLKG
SDYSWSYQTPPSSPSTTMSRKSSVCSSLNSVNSSDSRSSGSHSHSPSSHYRCRSSNLAQQ
APVRLSSVSSHDSGFISQDAFQSKSPSPMPPEAPTQLSNGFTHYSLSSESHVGPMGASLF
PHCPPASRLLPRVTSVHLPDYNHYYTIGPGMFPSSQIPSWKDWAKPGPYDQPLVNTLQRR
KEKREQDPSGGGPAAAGGPSAAAEEAQRPRSMTVSAATRPGEEMEACEELALALSRGLQL
DTQRSSRDSLQCSSGYSTQTTTPCCSEDTIPSQVSDYDYFSVSGDQEADQQQEFDKSSTI
PRNSDISQSYRRMFQAKRPASTAGLPTTLGPAMVTPGVATIRRTPSTKPSVRRGTIGAGP
IPIKTPVIPVKTPTVPDLPGVLPAAPDGPEERGEHSPESPSVGEGPQGVTSMPSSLWSGQ
ASVNPPLPGPKPSIPEEHRQAIPESEAEDQERDPSSATASPGRAPESEPADLSPRDAPQG
EDMLNAIRRGVKLKKTMTNDRSAPRFS
Download sequence
Identical sequences G1P0X6
ENSMLUP00000003437 ENSMLUP00000003437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]