SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003453 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003453
Domain Number 1 Region: 139-310
Classification Level Classification E-value
Superfamily Cyclophilin-like 2.78e-62
Family Cyclophilin (peptidylprolyl isomerase) 0.00000974
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003453   Gene: ENSMLUG00000003789   Transcript: ENSMLUT00000003788
Sequence length 313
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430145:79812:107023:1 gene:ENSMLUG00000003789 transcript:ENSMLUT00000003788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLCSEPGASAAMAGQCRSPSPPERPLQVKVVGVFKSSSFQIAKSTAECLKSNFPSKFDDP
IMVPLQEFAWDQYLQKKKRELKNEVWEYSSNVMCFINDLLLGDALELQKWAHKVWDMIDY
KPPALYEALTMDFSTKFLSDTKHNFVFLDISIGHHPVGRLVFELYCETCPKTCKNFQVLC
TGKAGFSQSGIKLHYVGSIFHRIVKNAWVQGGDIVAGKGDGGESIYGPTFEDESFSIPHN
KRGVLGMVNKGRHSNGSQFYITLQSAPYLDKKYVAFGQLVEGTDVLQQLELVPTENERPI
QQCTIIDSGNVYA
Download sequence
Identical sequences G1P0Z1
ENSMLUP00000003453 ENSMLUP00000003453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]