SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003490 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003490
Domain Number 1 Region: 15-143
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000185
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000003490
Domain Number - Region: 350-419
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00933
Family PDZ domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003490   Gene: ENSMLUG00000003821   Transcript: ENSMLUT00000003832
Sequence length 470
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429811:5192366:5205438:1 gene:ENSMLUG00000003821 transcript:ENSMLUT00000003832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRNRGPSGLGKQFTYYSENEVCKQDYFIKSPPPQLFSSAPSWKKRFFVLTRSGEKGFSLS
YYKDHHPRGSIKIDGNSSVDVGISSHEKMRTVQKMFKCHPDEVMSIRTTDREYFLIGSDR
EKIKDWVSFMSSFCRDLKAARPNAEQETLSLAAKRPSSDTSPLLGYSSTSEAVGSTTSRN
ILPDMHLMEKSPPGLRQAHLLHDFLPETTQDTEEESHYISPRSILLELDNIIASNESGEP
NELGSPDQVSERLEHHYMSMKSCLFKETTDESAGSEEESQALPEAQNRELHLQEQGSRND
SCLPPAKTEAQAMNGKKGSTSLTVVQLSVLINNIPEESHLERLNVFLSPLDVTNYLGLTE
AAGLICVAAWKGPPRLGCLFFHGDHILAVNDLKPHSLEEASLFLSRSIQKEKVKLTIGRI
PNSEKFHAIDCTCSLKYQDVVPSELEKSELERALKRSPAVRKGHQKRTGE
Download sequence
Identical sequences G1P121
ENSMLUP00000003490 ENSMLUP00000003490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]