SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003514 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000003514
Domain Number - Region: 279-318
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 0.0316
Family AlkB-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003514   Gene: ENSMLUG00000003855   Transcript: ENSMLUT00000003857
Sequence length 411
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430227:259353:289802:-1 gene:ENSMLUG00000003855 transcript:ENSMLUT00000003857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NPNVSCLSETRASPEKLRLFEELEDTWLPYLTPKDDEFYQQWQLKYPKLVLREAGSVPEE
LHREAQAAFATLHQHGCLARDLVRVQGKDVLTPVARLLVGNPGCTYKYLNTRLFAVPWPV
RGSNITYHQAEVAAACQTLLSLNSYLQLETVQAWEELVAKERANIDEVPVCIGPDFGLGI
FDGPDEADIRSRSAYNVTLLNFMDPQKMPYLKEEPYFGMGKMAVSWHHDENLVDRSAVAV
YSHSCEGPEEESDEDSPLEGRDPDTWHVGFKISWDIETPGLAIPLHQGDCYFMLDDLNAT
HQHCVLAGLPPRFSSTHRVAECSTGTLDYILQRCQLALQNVGDVTDSGGVSLKSLEPAVL
KQGEEIHNEVEFEWLRQFWFQGSRPRKCTDWWCQPMAQLEEMWRKMEGVVS
Download sequence
Identical sequences G1P140
ENSMLUP00000003514 ENSMLUP00000003514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]