SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003523 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003523
Domain Number 1 Region: 260-350
Classification Level Classification E-value
Superfamily PDZ domain-like 5.39e-22
Family PDZ domain 0.0000181
Further Details:      
 
Domain Number 2 Region: 92-187
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-21
Family PDZ domain 0.0000387
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003523   Gene: ENSMLUG00000003867   Transcript: ENSMLUT00000003867
Sequence length 872
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430175:151641:235945:1 gene:ENSMLUG00000003867 transcript:ENSMLUT00000003867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAGGHFWRAGPAGAQTAPLQARLGALHKALKKEALRAGKREKSLVAQLAAAQLELQMTAL
RYQKKFTEYSARLDSLSRCVAAPAGGKGEETKSLTLVLHRDAGSLGFNIIGGRPCADHQD
GSSSEGIFVSRIVDGPAAKDGGLQIHDRIVEVNGKDLSRATHDQAVEAFRTAKEPIVVQV
LRRTPRARAFPAPSEAQLVDAGTQTDITFEHIMALSKLSPPSPPALGPYLLPEEHPSAHE
YYDPSDYLSGAHQDLDREELELEEVDLYRANSQDKLGLTVCYRTDDEDDLGIYISEIDPN
SIAAQDGRIREGDRIIQINGIEVRNHEEAVALLTSEENKNFSLLIARPELQLDEGWMDDD
RNDFLDDLHMDMLEEQHHQAMQFTASALQQKKHEEDGGTTDTATILSNQHEKDSGVGRTD
ESTRNDESSEQENNGDEAAALAGQRTRTGSQDTLGSGDLPFSGESLLWADCADADDAECE
SFRQLLELKCPGRGAAESTDGELGLLDAELLELRCPARGADRGAPESVDRELELLNAELR
SIELECLSVVRAHRARQLREAWTLHPGGFRGCDTEADGRRHELSDITELPEKSDKDSSSA
YNTGESCRSTPLALDMSPDSSLRRGAEATTGACGPSPESPLCITEEADLRGASQSPERSP
GDGPSPAPPAHAPHKLAHIPAHARRYRSYMQLVQQKSAVEYAHSQVSLLGVCKDLGPAGP
PEPRTEWKVKVRSDGSRYITKRPVRDRLLRERALRIREERSGVTTDDDAASDMKLGRYWS
REERKQHVARAREQRRRRALLLQSRLDGPREQPADEDRREVSILELSHKKMMKKRNKKIL
DNWMTIQELLTHGTKSPDGTRVYNSFLSVTTV
Download sequence
Identical sequences G1P148
ENSMLUP00000003523 ENSMLUP00000003523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]