SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003532 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003532
Domain Number 1 Region: 6-101
Classification Level Classification E-value
Superfamily PH domain-like 7.13e-18
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.068
Further Details:      
 
Domain Number 2 Region: 322-430,545-669
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000987
Family Armadillo repeat 0.042
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000003532
Domain Number - Region: 142-233,284-397
Classification Level Classification E-value
Superfamily ARM repeat 0.0219
Family MIF4G domain-like 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003532   Gene: ENSMLUG00000003875   Transcript: ENSMLUT00000003876
Sequence length 854
Comment pep:novel scaffold:Myoluc2.0:GL429773:6903450:6950162:1 gene:ENSMLUG00000003875 transcript:ENSMLUT00000003876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDTRRRVKVYTLNEDRQWDDRGTGHVSSTYVEELKGMSLLVRAESDGSLLLESKINPNT
AYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVEVTQDLIDESEEE
RFEEMPETSHLIDLPTCELNKLEEIADLVTSVLSSPIRREKLALALENEGYIKKLLQLFQ
ACENLENTEGLHHLYEIIRGILFLNKATLFEVMFSDECIMDVVGCLEYDPALAQPKRHRE
FLTKTAKFKEVIPITDSELRQKIHQTYRVQYIQDIILPTPSVFEENFLSTLTSFIFFNKV
EIVSMLQEDEKFLSEVFAQLTDEATDDDKRRELVNFFKEFCAFSQTLQPQNRDAFFKTLA
KLGILPALEIVMGMDDLQVRSAATDIFSYLVEFSPSMVREFVMQEAQQSDDDILLINVVI
EQMICDTDPELGGAVQLMGLLRTLIDPENMLATTNKTEKSEFLNFFYNHCMHVLTAPLLT
NTSEDRYEKGFLFLKSKQYLNNVIILPNALHSHSTPPTNIPQVDNIVGSNKNSMICPDNY
QTAQLLALILELLTFCVEHHTYHIKNYIMNKDLLRRVLVLMNSKHTFLALCALRFMRRII
GLKDEFYNRYITKGNLFEPVINALLDNGTRYNLLNSAVIELFEFIRVEDIKSLTAHIVEN
FYKALESIEYVQTFKGLKTKYEQEKDRQNQKLNSVPSILRSNRFRRDAKALEEDEEMWFN
EDEEEEGKTVVAPVEKSKPEDDFPDSYEKFMETKKAKESEDKENLPKRTSSGGFKFTFSH
SASAANGANSTNSKSVMAQTPPASSNGSSSKTATLASSVTATKGSLVGLVDYPDDEEEDD
EEETSPRKRPRLGS
Download sequence
Identical sequences G1P157
ENSMLUP00000003532 ENSMLUP00000003532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]