SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003537 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003537
Domain Number 1 Region: 23-139
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000326
Family V set domains (antibody variable domain-like) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003537   Gene: ENSMLUG00000003881   Transcript: ENSMLUT00000003881
Sequence length 286
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429771:10064154:10096173:-1 gene:ENSMLUG00000003881 transcript:ENSMLUT00000003881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLLLGLLFLGHLMMVTYGHPILEAPESVTGPWKGDVNIPCTFAPLKGYTQVLVKWLVRR
DSNPITIFLRDSSGDHIQQAKYRGRLHINREVLGDVSLQLKTLEMDDRSHYTCEVTWQTP
NGNQVVRDKIIELRVQKHSSKPHKTKTEAPTTIQFPLEIMPTVNSSWGWTTEVHRHLEET
NAGPGKGLPIFAIIFIIILCCMVVFIMTYIMLSRKTSQQEHVYEEARVHAWETSNSGETM
RLAICESGCSSEEPATWTLGNDYSDEPCLDQEYQIIAQDSTTCLTC
Download sequence
Identical sequences G1P162
ENSMLUP00000003537 ENSMLUP00000003537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]