SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003560 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003560
Domain Number 1 Region: 102-200
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-18
Family PDZ domain 0.00011
Further Details:      
 
Domain Number 2 Region: 189-289
Classification Level Classification E-value
Superfamily PDZ domain-like 9.99e-17
Family PDZ domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003560   Gene: ENSMLUG00000003905   Transcript: ENSMLUT00000003906
Sequence length 292
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429827:881629:890526:1 gene:ENSMLUG00000003905 transcript:ENSMLUT00000003906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTLYPSLEDLKVDQAVQAQARDTPKMPILPVQETPVPQPPVLYPNLAELENYMGLSLSS
QEVQQNLPQSPDGTSTVVSGPSPGQVVAPVSGNSLGVRRAEIKPGVREIHLCKDERGKTG
LRLRAINKGLFVQLVQVNTPASLVGLRFGDQILQIDGRDCAGWSTDRAHRAVKRASAEKI
VMVVRDRPFQRTVTMHRDSTGHVGFVIKKGKVVSIVKGSSAARNGLLTNHYVCEVNGQNV
IGLKQRGVTEILATAGSVITLTIIPTVIYEHMVKKLSPTLLRHTMDHSIPDV
Download sequence
Identical sequences G1P183
ENSMLUP00000003560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]