SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003571 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003571
Domain Number 1 Region: 61-322
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.11e-45
Family Ankyrin repeat 0.0002
Further Details:      
 
Domain Number 2 Region: 398-440
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000249
Family SOCS box-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003571   Gene: ENSMLUG00000003922   Transcript: ENSMLUT00000003922
Sequence length 447
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429867:327407:333763:-1 gene:ENSMLUG00000003922 transcript:ENSMLUT00000003922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGTFPFTSATLRALRLQREWLEWEDRRRAAAQLCRSQRCPPSSLARLTRPRRSCRDPA
VHNALFSGNLQQVQALFQDEDAANMIVETESNQLAWSPEQGFWVLTPKTKQTVPLTIAAA
RGYTDCARHLIRQGAELDARVGGRAALHEACAQAHSDCVRLLLFGAKANVLSEEGTTPLH
LCTAPESLQCAKLLLEAGATVNAAARDSEMTPLHVAAARGLEEHVALYLAHGADVGLRTS
QGETALNAACAGAEGPNGRRHQAVARQLLEAGADARAAGRKRHTPLHNACANGCGALAEL
LLRHGACAGVSNAAGHTPMDCVLQAVQDTPNWEPEVLFGALLDYGAQPVHPEMLKHCANL
PRALEVLLNAYPCVPSCDTWVEELWQEHEAFYSSALAMVNQPRRLQHLARLAVRAQLGNR
CRQAADRLPLPQLLRDYLLLRVEGRIQ
Download sequence
Identical sequences G1P193
ENSMLUP00000003571 ENSMLUP00000003571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]