SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003601 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003601
Domain Number 1 Region: 367-721
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.34e-87
Family Protein kinases, catalytic subunit 0.00000174
Further Details:      
 
Domain Number 2 Region: 182-282
Classification Level Classification E-value
Superfamily MAST3 pre-PK domain-like 2.88e-42
Family MAST3 pre-PK domain-like 0.00000228
Further Details:      
 
Domain Number 3 Region: 945-1034
Classification Level Classification E-value
Superfamily PDZ domain-like 6.31e-19
Family PDZ domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003601   Gene: ENSMLUG00000003943   Transcript: ENSMLUT00000003954
Sequence length 1301
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430078:28576:64018:1 gene:ENSMLUG00000003943 transcript:ENSMLUT00000003954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEPSLLRRRGLQKELSLPRRGRGCRSGNRKSLVVGTPSPTLSRPLSPLSVPTAGNSPLD
SPRNFSAVSAVNFPFARRADGRRWSLASLPSSGYGTNTPSSTVSSSSSSREHLHQLPFQP
TPDELRFLSKHFRSSESVADEEGGHRSPRLRPRSRSLSPGRTTGTFDNEIVMMNHVYRER
FPKATAQMEGRLQEFLTAYSPGAQLALADGVLGFIHHQIVELARDCLAKSGEALVTSRYF
LEMQDKLERLLQDAHERSDSEEVGFVVQLVRKLLIIISRPARLLECLEFDPEEFYHLLEA
AEGQAREGQGIKTDLPQYIIGQLGLTKDPLEEMVPLSHLDDKGQPPAPESLESRALVGPS
RRKPCESDFETIKLISNGAYGAVYLVRHRDTRQRFAIKKINKQNLILRNQIQQVFVERDI
LTFAENPFVVSMFCSFETRRHLCMVMEYVEGGDCATLLKNMGPLPVDMARMYFAETVLAL
EYLHNYGIVHRDLKPDNLLITSLGHIKLTDFGLSKIGLMSMATNLYEGHIEKDTREFMDK
QVCGTPEYIAPEVIFRQGYGKPVDWWAMGVVLYEFLVGCVPFFGDTPEELFGQVVSDEIM
WPEGEEALPADAQDLITRLLRQSPLDRLGTGGTHEVKQHPFFWTLDWAGLLRHKAEFVPQ
LEAEDDTSYFDTRSERYRHLGSEDDETNDEESSTEIPQFSSCSHRFSKVYSSSEFLAVQP
TLPFTERSFSEDREEGWERGEGECGRQLSTEVRLRSWTSSGSSCYSSSSQPERGPSPSLM
STISLDTMPKFAFSSEDEGAGPGPVGPKRPVFILGEPDLPLAATPGAPKPSSLSADPTAL
GQTRLRSNSTGARHSTPRALDASRGHRLRGPKDLAPEKSRAASSGGCMPKSASVSALSLI
ITADDGSGGPLMSPLSPRSLSSNPSSRDSSPSRDPSPVCGSLRPPIVIHCSGKKYGFSLR
AIRVYMGDSDVYTVHHVVWSVEEGSPAHQAGLRAGDLITHVNGESVLGLVHMDVVELLLK
SSNKITLRTTALENTSIKVGPARKNVAKGRMARRSKRSRRRETQDRRKSLFKKISKQSSV
LHTSRSFSSGLHHSLSSSESLPGSPTHSLSPSPTMPSRSPASDALAATDTASPPNASPSS
SSPASPATAGHTRPSSLHGLAAKLGPPRPKSGRRKSTSSIPPSPLACPPVPAPPPRSPSP
LPAPTRSPRLRRGQSAEKLGAGERLEGELGRRSRGPDSELVVMRRLHLSERRDSFKKQEA
VQEVSFDEPLEEAARLPAVMPQIAVEGAEAVPGALGPTEKD
Download sequence
Identical sequences G1P1B7
ENSMLUP00000003601 ENSMLUP00000003601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]